KEGG   Halobacteriovorax marinus: BMS_1643Help
Entry
BMS_1643          CDS       T01659                                 

Gene name
murI
Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00471  D-Glutamine and D-glutamate metabolism
bmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMS_1643 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmx01011]
    BMS_1643 (murI)
Enzymes [BR:bmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BMS_1643 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bmx01011]
 Precursor biosynthesis
  Racemase
   BMS_1643 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1374
Motif
Other DBs
NCBI-ProteinID: CBW26486
UniProt: E1X195
Position
1627823..1628593
Genome map
AA seq 256 aa AA seqDB search
MGQRKALSIGIFDSGIGGFSILKKIHELAPELEVYYIADQGFAPYGNKSRKEVIDRCHYL
CHELMKFDLDLIVVACNTATGVAIDELRNTFTIPFVGVEPFVNALSKHTWKESDRACVIT
TELMSKSERFQKLVNRLDPDKRLFYKVTPGLATIVEDFFINKNEEELNLKLKEELSFVGE
SSYSHLILGCTHYPLIAKYIEATTGASVLSPCLYVANRVLSLLDLSSGENSETFQFASTA
KEDVLRFVSKDFSNLP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaagaaaagcattatctataggtatttttgattcaggtattggaggattttca
atcttaaagaaaattcatgaactagcgcctgagttagaggtctattatattgctgatcag
ggctttgctccctatggaaataaatctagaaaagaggtgatcgatcgctgtcactacctt
tgccatgaactcatgaaatttgatttagatttaattgtcgttgcctgtaatacggcaaca
ggtgtggccattgatgagcttagaaatacttttaccattccgtttgtaggggtagagcca
tttgtaaatgcattgtctaagcacacttggaaagagagtgatagggcctgtgttattacc
actgaattaatgtccaagagtgagcgctttcaaaaacttgttaatagacttgacccagat
aagcgactcttctacaaagtcactccaggacttgctacaatagttgaagacttctttatt
aataagaatgaagaagaactcaatctaaaacttaaggaagagctatcatttgtgggggag
agttcttactctcatcttattcttggttgcacacactatcccctgattgctaagtatatt
gaagcaactacaggagcaagtgttctctctccatgtctctatgtggccaatagagttctc
tcccttttagatttaagttcaggtgagaattctgagacattccaatttgcaagcaccgct
aaggaagatgtcctacgctttgtgtccaaagatttttccaatttgccctag

DBGET integrated database retrieval system