KEGG   Halobacteriovorax marinus: BMS_1821Help
Entry
BMS_1821          CDS       T01659                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00071  Fatty acid degradation
bmx00280  Valine, leucine and isoleucine degradation
bmx00281  Geraniol degradation
bmx00310  Lysine degradation
bmx00362  Benzoate degradation
bmx00380  Tryptophan metabolism
bmx00410  beta-Alanine metabolism
bmx00640  Propanoate metabolism
bmx00650  Butanoate metabolism
bmx00903  Limonene and pinene degradation
bmx00930  Caprolactam degradation
bmx01040  Biosynthesis of unsaturated fatty acids
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
bmx01212  Fatty acid metabolism
Module
bmx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMS_1821 (fadB)
   00650 Butanoate metabolism
    BMS_1821 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BMS_1821 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BMS_1821 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMS_1821 (fadB)
   00310 Lysine degradation
    BMS_1821 (fadB)
   00380 Tryptophan metabolism
    BMS_1821 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMS_1821 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMS_1821 (fadB)
   00281 Geraniol degradation
    BMS_1821 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMS_1821 (fadB)
   00930 Caprolactam degradation
    BMS_1821 (fadB)
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BMS_1821 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMS_1821 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BMS_1821 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CBW26643
UniProt: E1X1Y3
Position
complement(1805028..1807148)
Genome map
AA seq 706 aa AA seqDB search
MESKRISFEIEESIAYLGFGYNCTKSMTTLDEETLQELSDRLDELHKNKDIKGVVFWSHK
DRCFLAGADINLISSMKTESDGASGAEAGQTIFNKIEDLKVPTIAAVHGVCLGGGLELSL
SCKAIVASDDKGTMLGLPEVKLGLIPGFGGTYRLPRKIGLPKALDVILTGKMLKAKKAKR
LGLVAGVYPKERIKKMASFHFGGDEKKGGLKESLEHIASDNFFAKKIIFQKARESVLKKT
KGFYQAPLKILDVMEAGIMKGRSSYLAAESQAFGELCVSEQSKNLQHIFFMTETAKKYSG
PESSGNLPRLKKGAALGAGTMGGGIAWLMANNGMAPLMKDLTPEALELGYKQSSSNFMGA
VKRKRMTRDEFERKQRSIQGQVGYDGFERVDLVIEAIVENMNIKKSVFSEVETKVRKDCV
ITSNTSSLSVQEMSTALENPERFAGLHFFNPVHMMPLVEIITHDKVAPETLEALYNWCMK
VKKTPVIVKDGPGFLVNRILMPFMNEAGFLLEEGVPMKDIDDACLNFGMPMGPCRLLDEV
GIDVGEKVAKIIHDGLGDRVKSSPFSSKLVEKNFLGKKNGKGFYIYDKRGKVEGPNEEVQ
AMLPKTKKKMDETEIQMRIFLPMINEAATVLADGIVESAAQVDLGLIFGIGFPPFRGGLL
RYADSEGLERLIKAMEDRAESVDKDRYTPCDFLKDLAAQKKKFYDV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaaagagaattagttttgaaatagaagaaagtattgcttacttaggctttgga
tataattgtactaagtcaatgacaactctagatgaggagacattgcaagagttatctgat
cgtctagatgagctacataagaataaagatattaaaggtgttgtcttctggtcacataaa
gatagatgtttcttggccggagctgacattaacctcatttcatcaatgaagacggaaagt
gatggtgcatctggtgctgaagctggtcaaacaatttttaataaaattgaagaccttaaa
gttcctacgattgcagcagttcacggtgtatgtcttggtggtggacttgagttatctctt
tcatgtaaggccattgttgcctctgatgacaagggaacaatgcttggtcttccagaagtt
aaattaggacttattcctggttttggtggaacttatagactcccaagaaagataggtctt
ccaaaggcattggacgttattttaactgggaaaatgttaaaggctaaaaaggccaagcga
ctaggtcttgtggcaggtgtttatccaaaagagagaattaaaaagatggcgtcttttcac
tttggtggagacgagaagaagggtggattaaaggaatcccttgaacatattgcatctgat
aacttctttgctaagaaaattatttttcaaaaagctagggagagtgttctaaagaagaca
aagggattctaccaagcacctcttaagattttagatgtgatggaagctggaattatgaag
ggaagatctagctaccttgcagctgagtctcaggcctttggagagctttgtgtaagtgag
caatctaagaatttacagcatatcttctttatgactgaaacagctaagaaatactctgga
cctgagagctctggaaatcttccacgcttaaaaaagggcgcggcccttggagctggaacg
atgggtggtggaattgcatggcttatggccaataatggaatggccccactcatgaaagat
ttaactcctgaagctctagagcttggatataaacaatcttcttcaaacttcatgggagca
gtgaagagaaagagaatgactcgcgatgaatttgaacgcaagcagcgctcgattcaaggt
caagttggttacgatggttttgaaagagttgatcttgttatcgaggccattgttgaaaat
atgaatattaaaaagagtgttttctctgaagtagaaactaaggtgagaaaggattgtgta
atcacttctaatacatcttcactttctgttcaggagatgagtacggccctagagaatcct
gagcgttttgcaggtctccacttctttaatcctgttcatatgatgcctcttgtagagatt
atcactcatgataaagttgctccggaaacacttgaggccctctataattggtgtatgaaa
gttaagaagacaccagttatcgtaaaagatggaccaggttttcttgtaaatagaatctta
atgccatttatgaatgaggcaggtttccttctagaagaaggtgttcctatgaaagatata
gacgacgcttgtcttaacttcggtatgcctatgggtccttgtcgtctattagacgaagta
ggaatagacgtaggggagaaagttgcaaagattatccatgatggtctaggtgatagagtt
aagtcttctccgttctcttctaaacttgtagagaagaacttcttaggtaagaagaatgga
aaaggtttctatatctacgacaagagaggaaaggtagaagggccaaatgaagaagttcag
gccatgctacctaagactaagaaaaagatggatgagacagaaattcagatgagaatcttc
cttccaatgatcaacgaagctgctacagtgctggccgacggtattgtcgaaagtgctgct
caagtagatcttggtcttatctttggaattggatttcctccatttagaggaggacttctt
cgctacgctgactctgaaggtttagagagacttattaaagcgatggaagatagagctgag
tctgttgataaagacagatacactccttgtgatttcttaaaagatttagcagcacagaag
aagaagttctacgacgtttaa

DBGET integrated database retrieval system