KEGG   Halobacteriovorax marinus: BMS_2187Help
Entry
BMS_2187          CDS       T01659                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00020  Citrate cycle (TCA cycle)
bmx00640  Propanoate metabolism
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
Module
bmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_2187 (sucC)
   00640 Propanoate metabolism
    BMS_2187 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BMS_2187 (sucC)
Enzymes [BR:bmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMS_2187 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBW26993
UniProt: E1X3R4
Position
complement(2212954..2214126)
Genome map
AA seq 390 aa AA seqDB search
MNVHEYQAKELMKKFGIKVLGGQVAKSVDEAVEGAKKLGGNVWVVKAQIHAGGRGKAGGV
KLAKNLDEVKAHADDILGKTLVTHQTGPEGKKVLTLLVEEGCEIEHEYYAGIVLDRATGK
ITFMASSEGGVEIEKVAEETPEKIIKVAVDPAAGFTPFIGRKLAYGIGIKDKDLVKEATK
FFKGLYDLYVDTDCTIAEINPLVKTKQGEIIALDAKLNFDDNALFRHPEIEEMRDPTEES
AEELDAAKYGLSYISLDGNIGCLVNGAGLAMGTMDIIKLHGGEPANFLDVGGGATKETVE
KAFSIILSDSNVKAILVNIFGGIMKCDIIAEGVVAAAKSLGVTVPLVVRLEGTNVALGKK
ILNESDLTIIAADDLADAAAKVVEATKGDA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacatgagtaccaggccaaagaactaatgaagaaatttggtattaaagttctt
ggtggtcaggtagctaagtccgtcgacgaagccgttgaaggagccaagaagcttggtgga
aatgtttgggttgttaaagctcagatccatgctggtggtagaggtaaagctggcggagta
aaacttgcaaagaacttagatgaagttaaagcacacgctgacgacattttaggtaaaaca
ctagttactcatcaaacaggaccagaaggtaagaaagttcttactcttttagttgaagaa
ggttgtgagattgagcacgagtactacgcaggtatcgtattagatagagcaacaggaaag
atcactttcatggcatctagtgaaggtggtgttgaaattgaaaaagttgcagaagaaact
cctgagaaaatcataaaggtagccgttgatccagctgctggcttcactccatttattgga
agaaagcttgcttacggtatcggtattaaagataaggatcttgttaaagaagcaacgaaa
ttctttaaaggtctttacgatctctacgtagacactgattgtactattgcagagatcaac
cctttagttaaaactaagcaaggtgaaattattgcactagatgcaaaattaaactttgat
gacaacgctctctttagacatcctgaaattgaagaaatgagagatccaacagaagagtcg
gctgaagagctagacgcagctaagtatggtctttcttatatttcacttgatggaaatatt
ggttgtctcgtaaatggtgccggtcttgcgatgggtactatggatattattaagcttcac
ggtggtgagccagctaacttcttagacgttggtggtggagctactaaagagacagttgag
aaagcattctcaattattctttcagactcaaacgttaaggccatcctagtaaatatcttt
ggtggaattatgaagtgtgacatcatcgccgaaggtgttgttgctgctgctaagtctctt
ggtgtaacagttcctctagttgtaagacttgagggaacaaacgttgctcttgggaagaaa
attcttaacgaatccgatttaactattattgctgctgacgaccttgcagatgctgctgct
aaagttgttgaagcaacaaaaggggatgcgtaa

DBGET integrated database retrieval system