KEGG   Halobacteriovorax marinus: BMS_2765Help
Entry
BMS_2765          CDS       T01659                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00071  Fatty acid degradation
bmx00072  Synthesis and degradation of ketone bodies
bmx00280  Valine, leucine and isoleucine degradation
bmx00310  Lysine degradation
bmx00362  Benzoate degradation
bmx00380  Tryptophan metabolism
bmx00620  Pyruvate metabolism
bmx00630  Glyoxylate and dicarboxylate metabolism
bmx00640  Propanoate metabolism
bmx00650  Butanoate metabolism
bmx00900  Terpenoid backbone biosynthesis
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
bmx01212  Fatty acid metabolism
bmx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMS_2765
   00630 Glyoxylate and dicarboxylate metabolism
    BMS_2765
   00640 Propanoate metabolism
    BMS_2765
   00650 Butanoate metabolism
    BMS_2765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMS_2765
   00072 Synthesis and degradation of ketone bodies
    BMS_2765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMS_2765
   00310 Lysine degradation
    BMS_2765
   00380 Tryptophan metabolism
    BMS_2765
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMS_2765
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMS_2765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMS_2765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmx04147]
    BMS_2765
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMS_2765
Exosome [BR:bmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMS_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Dodecin ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBW27541
UniProt: E1WXM3
Position
complement(2765389..2766552)
Genome map
AA seq 387 aa AA seqDB search
MSVYILSGARTPSGSFLGSLSSVPAPKLGAAAIQGAVTKANVDASKVDEVFMGNVITAGV
GQAPARQAALFAELPESVPCTTVNKVCGSGLKTIIMGAQSIKCGDNSVVVAGGMENMSLA
PHLIMNSRTGVSKFGGAEMKDSMQWDGLWDVYSDRPMGNCAEECVSKFNFTREQQDEFSI
ESFKRAQNAANEGIFKEEIVPVTIKGRKGDTIVSEDEGPFKANFEKIPALRPAFDKNGTI
TAANASTINDGAAAVVLGGEEYKDQAKFKILSWASHAQNPTWFTTAPAGAMQKALDKAGL
KIEDIELFEINEAFAAVTMAAMEEFKISRDKVNVFGGGVSLGHPIGCSGTRIVVTLMNAL
EKKNAKYGMAAICIGGGEALSLIVERM
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttacatactatcgggagcgagaactcctagtggaagttttttaggatcatta
tctagtgtaccagcgcctaagcttggtgctgcagctattcaaggtgccgtgactaaggca
aatgtagatgcttcaaaagtagacgaagtatttatgggtaatgttattacagctggcgta
ggacaagctcctgcaagacaggccgctctctttgctgagctaccagagtctgttccttgt
acaacagttaataaagtttgtggttctgggcttaagacaattattatgggcgctcaatca
attaagtgtggtgacaactcagtagtcgttgctggtggaatggagaatatgtctttggcc
cctcacttaattatgaactctagaactggagtttcaaaatttggtggtgcagagatgaaa
gattctatgcagtgggatggactatgggacgtttattcagacagaccaatggggaattgt
gctgaagagtgtgtttcaaaattcaactttacacgtgaacaacaagatgagttttcaatt
gagtcttttaagagagctcaaaatgcagctaatgaaggaatcttcaaagaagagattgtt
ccagtaacgatcaaaggtagaaagggagacactattgtttctgaagatgagggtccattc
aaagcaaactttgaaaagattcctgcacttcgtcctgcgtttgataagaatggaacgatt
acagcggccaatgcctcaacaattaatgatggtgcagcagctgtggttttaggcggagag
gaatataaagatcaagcaaaatttaagattctatcttgggcttctcatgcgcagaatcca
acttggtttacgactgctccggcaggagcaatgcagaaggcactagataaggccggacta
aagattgaagacatagagttatttgaaatcaatgaagcttttgctgcagtaactatggcg
gcgatggaagaatttaaaatttctagagataaggtaaatgtctttggtggtggtgtgagc
ctaggtcacccaattggttgttcaggaacgagaatagtggttacacttatgaacgctctt
gaaaagaagaatgctaaatacggtatggccgcaatttgtattggtggcggagaagcacta
agcttaatagtagaaagaatgtaa

DBGET integrated database retrieval system