KEGG   Halobacteriovorax marinus: BMS_2885Help
Entry
BMS_2885          CDS       T01659                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00010  Glycolysis / Gluconeogenesis
bmx00051  Fructose and mannose metabolism
bmx00562  Inositol phosphate metabolism
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
bmx01230  Biosynthesis of amino acids
Module
bmx_M00002  Glycolysis, core module involving three-carbon compounds
bmx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMS_2885 (tpiA)
   00051 Fructose and mannose metabolism
    BMS_2885 (tpiA)
   00562 Inositol phosphate metabolism
    BMS_2885 (tpiA)
Enzymes [BR:bmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMS_2885 (tpiA)
Exosome [BR:bmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMS_2885 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMS_2885 (tpiA)
  Exosomal proteins of melanoma cells
   BMS_2885 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBW27657
UniProt: E1WYL7
Position
2884736..2885476
Genome map
AA seq 246 aa AA seqDB search
MREIHIVGNWKMNQELEQVREFAKALEAMPSLNCQAWIAPQAIHVTTLLSATSKVKVGAQ
NCSNHNSGAFTGETSPKSLKDLGAHFVIIGHSERRAIFNEEDTLLNEKVLNALDNGLKTI
LCVGETLEQRESGEFKDVLATQLHSGLKGIKAADKENIIIAYEPVWAIGTGKVASPEQAA
EVHTFLREELSKVEALDSEQTPILYGGSVKPENIEGLLEKVDIDGALVGGASLKADSFME
LCKLSK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatacatatcgttggaaattggaaaatgaatcaagagcttgaacaagttcgt
gaatttgccaaggcccttgaagcaatgccctctctcaattgccaggcatggattgctcca
caagcgattcacgttacaactctattgagtgcgacttctaaagttaaggttggtgcccag
aattgctctaaccacaactcaggagccttcactggagaaacaagtcctaaatcacttaaa
gaccttggtgcacactttgtcatcattggtcactctgagagaagggccatttttaacgaa
gaagacactcttttaaatgaaaaggtcctaaacgctctagataacggactcaagactatt
ctctgtgttggagaaactcttgagcaaagagagagtggagaatttaaagatgtcttggcc
actcaacttcactcaggactaaaaggtattaaagcagctgacaaagaaaatatcatcatt
gcatatgagccagtttgggccattgggacaggaaaagttgcttcaccagaacaagcggcg
gaagttcacactttcctcagagaggaattatctaaagttgaggccctagactctgagcaa
acacctattctctatggcggtagcgtaaagcctgaaaatattgaaggcttattagaaaaa
gtagatattgatggagctttggttggaggagcctctcttaaagccgatagtttcatggaa
ttatgtaaattaagtaaataa

DBGET integrated database retrieval system