KEGG   Brugia malayi (filaria): Bm1_00350Help
Entry
Bm1_00350         CDS       T01050                                 

Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] alpha-chain, mitochindrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00020  Citrate cycle (TCA cycle)
bmy00640  Propanoate metabolism
bmy01100  Metabolic pathways
bmy01200  Carbon metabolism
Module
bmy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bm1_00350
   00640 Propanoate metabolism
    Bm1_00350
Enzymes [BR:bmy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Bm1_00350
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bm1_00350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 6095041
NCBI-ProteinID: XP_001891596
UniProt: A0A1P6BM13 A0A4E9EQC3
AA seq 325 aa AA seqDB search
MSSLRTVKLGRQTHAIGIGLLRHYTSTRSALRINKDTKVIIQGFTGKQATFHGQQMINYN
TNVVGGVSPNKAGTMHLERPVFGTVKEAREATGADASVIYVPARFAAKAIDEAIDAEIPL
VVCVTEGVPQQDMVKVRNRLMKQNKTRLLGPNCPGIICPEECKIGIMPGHIHRKGTIGVV
SRSGTLTYEAVHQTTVCGLGQTLCVGIGGDPFNGTNFIDCLDIFLRDPQTKGIILIGEIG
GQDEEKAAEFLKENNSGSNAKPVVSFIAGQTAPPGRRMGHAGAIIAGGKGTAADKIEALK
SVGVLVSASPAQMGAMMAKALMKKI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcattacgaacagtcaagcttggccggcaaactcatgcaattggtataggattg
ctacgacattatacgagtactcgaagtgcattacggattaataaagatacgaaagtgata
attcaagggtttactgggaaacaagcaacttttcatggccagcaaatgatcaattataat
actaatgttgttggaggtgtttctccaaacaaagccggtacaatgcatcttgaaagacct
gtttttggtactgttaaagaagctcgtgaagcaacaggtgcggatgcatcagttatttat
gtaccggcacgctttgcagctaaagcgatcgacgaagcaatagatgcggaaattccactg
gttgtttgtgttacggaaggtgttccacaacaagatatggttaaagttcgaaatagacta
atgaaacagaacaagactcgtctgcttggtccaaactgtccagggataatttgtccggaa
gaatgcaaaataggtattatgccgggacatatacatcgaaaaggaactattggcgttgtt
tcacgatctggaactcttacatatgaggcagttcaccagacgacggtttgtggtcttgga
caaacattatgtgttggcattggtggtgatccattcaatggcacaaatttcattgattgt
cttgatattttcttgagagatcctcaaactaagggtattattttaattggcgagattggt
ggacaagatgaagaaaaagctgcagagtttttaaaggaaaataattcgggatcaaatgct
aagccagtagtatcattcattgccgggcagactgcaccgccaggtcggcgaatgggacat
gccggtgcgattattgcgggtggtaaaggaactgccgctgataaaattgaagctttgaaa
agtgttggtgtcctcgtctcggcatcaccagcgcagatgggtgcaatgatggcaaaagct
ctgatgaagaaaatctaa

DBGET integrated database retrieval system