KEGG   Brugia malayi (filaria): Bm1_05655Help
Entry
Bm1_05655         CDS       T01050                                 

Definition
(RefSeq) Phosphatidylinositol 3- and 4-kinase family protein
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00562  Inositol phosphate metabolism
bmy01100  Metabolic pathways
bmy04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bm1_05655
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Bm1_05655
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     Bm1_05655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX C2 PI3K_C2 PI3K_rbd DUF4135
Motif
Other DBs
NCBI-GeneID: 6096059
NCBI-ProteinID: XP_001892604
AA seq 1543 aa AA seqDB search
MRTSDYVYDRDLELALELSRQSYKEESRKRRENAYAQDLICWDDVEKNTQEVNECNSDIR
SRCLTYTHTFPNRQSHYANIPTTSGNTGFYPHMKHDKQDNLHSLQHRLESSTLTRYLPDM
LSGTEANDTSGIIEQRVDAPDATLIMLSPSSSAVVVPFCSSVKSLQTNSDLIDLSDKEQS
KGNDSSLFVSALEPSESIPSSRLAINDKGNGLAPCKPPRAQRSGRNESVVSTGRHQIDFD
EIQLQEKPSEVDREIASLLRRSPQHCDPISRRFISPVVDYLITSFKVTSVKVIVEKDYSW
PTILSADDRMTFTCETTSTIQYILANVLNTFLDPSQISMLQDRLPVDEYGLKIYGLDEFL
LSSSQLGENPFVGQALAFGKDIRLEVGKIASDNRSKKIYQLDVPTVDGSPRRSSQPSSKK
PDPVVRTVTNVREILDALKNSLRSCSDTHFDNSALKNKERVSQSVKLLCTVLGRIITTDL
STALRLFLAAETATFSNSEREQRDILTVDEQLLVHVDSVHNIPREWSQEFSLFSVAVHVM
HGTAEICRGFKENPRPIINDHFFPYCRTNTWACFRIPFCVLPRETRIFILLYGTSLSGDH
DLQVHPPNVPTETQTLLEKQLACASFPLFDHEGLLRQGSLLLPLSAINGKVVYPWGPRPL
FETEDDLVVLVTLPQLHYDVIFPCVNYGENSLKRDFNSLDSDTQQNLLDIVESGVTHSLT
EDEKEALWEKRHYLTHIPDALPLVLASAVGWDWASLTNIYQLLDDWMPLSSVQAIELLLP
HFPDLTIRSKAISWLKNASSDFLFNFLPELVEALRFETFEDSSLAVYLLTLCAGDRRFAF
ELYWQLQQRIDQCQERSYSNRCSLLQQQILRLLDDEFGIDIENQHRLLQALNVASCEMKE
AGDASKMQLTLQRHLALLDARILENNVRLPLLPSFLCTGISVSECSYFNSLTKPIKVTFK
GLKSSFAILYKVGDDMRQDALVLQLVKVMNDIWLSQELDLRMVIFRCISFGNKSGTKSYF
KGMVELVPDCRTLCEIQSAVGATGVFKDDLLKKWLEMHNPSEFQYKIALENFHLSCAGWC
VATYVLGIGDRHNDNILVTRTGHVFHIDFGKYMGDWQTAVGFRRDRTPFIFTSDMAYVIN
EGSPQSATSRYQHFVDNCCKAFNLLRKKYSLLVNLMKMMSCSGIAGMNLEAVNFVQSNLL
LNLTDTQATVQFTRMIEESLKSKFPRLNFLAHTLVQMRGTPSMLRGGYDDPNKLSFIQQL
YTMKDDGRITRVDVLAFEKWHIPEKVYMYKVEVNRENEAVCGIVYRSFVEFNELYIKLCR
RFPFAHLPPLSQGTNVGRSNIRKVAERRQADLQQFLNVLFEYHPEVASSDLVYTFFHIIF
RDSAPDESNQFLQLTKVDEDDIPSKKVTGRIFLRLTYDQQDGNLNVFVGHVRGLKIINGQ
APDSYVKTYLRPDPQRSSKRKTHVVKNTQMPTFNEELNYQLLSDTNLVNRALEVSVWNCG
SLVGENSVIGFVHIPLRKLLDTPTDRKGIQVLDGWFNLRTGSR
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
atgagaactagtgattacgtttatgatagggatttggagctggcgctggaacttagtagg
cagtcatataaagaggaatcacgcaagcgaagggaaaatgcatatgctcaggatttgatt
tgttgggatgatgttgaaaaaaatactcaagaagtcaatgagtgtaattctgacattcga
agtcgctgtctcacatatacccatacatttccaaatcgacaatcacattatgcgaacatt
ccaacaacgtcaggaaacactggtttttatccacacatgaaacatgacaaacaagacaat
ctgcattccttacagcacagactggagtcgagtactctcacacgttaccttcctgatatg
ttatctggcacggaagcgaatgatacttctggaatcattgagcagcgggttgatgctcct
gatgctaccttgataatgttatctccatcgagcagtgcagttgttgttcctttctgttcc
tctgttaaaagtttgcaaacaaacagcgatttgattgatctaagcgataaagaacagagt
aaaggcaatgattcttcgctatttgtatctgcattggaaccgtcggagtcgattccatca
tctcgtttggctattaatgataaaggtaatggcttagctccgtgtaaacctccgagagca
cagaggagtggacgaaatgaatctgtagtttctaccggacgacatcaaattgattttgac
gaaatacagttgcaagagaaaccttcagaagttgatcgtgagattgcttctcttcttcgt
cgttcccctcagcactgtgatccaatatcaaggcgtttcatatcacctgtcgtggattac
ttaatcacaagttttaaagttaccagtgtaaaagtaatcgttgagaaagactacagttgg
ccgacaatattaagtgcagacgatagaatgacgttcacctgtgaaacgacaagtacaatc
cagtacattttggcaaatgtgttaaacacattccttgatccttcacaaatcagtatgctg
caagatcgtttaccagtcgatgaatatggcctgaaaatttatgggttggatgaatttctt
cttagcagttctcaacttggtgagaatccatttgttggacaggcacttgcttttggaaaa
gatatacgacttgaggttgggaaaatagcaagtgacaatcgatccaaaaaaatataccag
cttgatgtaccaactgttgatggcagtccaagacgttcttcccaacccagttcgaagaag
cctgatcctgtagtgcgaacagtaacaaatgttcgagaaattttggatgcactaaagaat
tcgctgcgtagctgttctgacacacattttgataatagtgcgctgaagaataaagaaaga
gtaagccagtcagtgaagcttctttgtactgttcttgggcgcattataacaactgatcta
tctacagctttgcgtttatttcttgctgcagaaacggcgacattttcgaatagtgagcgt
gaacagcgggacatcctaacggtggatgagcagctattagtgcatgttgattcagtccac
aatataccacgagaatggtcacaggagttcagtttattctcggttgctgtccatgtaatg
catggaacagcagaaatatgtcgaggttttaaagaaaatcctcggcctatcatcaatgat
catttcttcccatactgtcgaactaatacttgggcctgttttcgcatcccattttgtgtt
ttacctagagaaacgcgcatttttatcctgctttatgggacttcactttctggtgatcat
gatctgcaggttcatccaccgaatgtgccaactgaaacgcaaacattacttgaaaaacaa
cttgcttgcgcttctttcccactgttcgatcacgaaggcctacttcgacaaggatctctt
cttttgccactctctgctatcaatggaaaagtggtttatccatggggacctcgaccattg
ttcgaaacggaggatgatctcgttgtacttgttacattaccgcaattacattatgatgtt
atcttcccatgtgttaactacggcgaaaatagtctgaaacgcgatttcaactctcttgat
tcggatacacagcaaaatttactggatattgtagaaagcggagttactcacagtttaact
gaggatgaaaaggaagcgttatgggaaaaacgacattatttgactcatataccggacgca
ttacctttagtgcttgcttctgccgttggttgggattgggcatcattaacgaacatttat
cagttgctagatgactggatgccgttgagttcagtgcaagcgatcgaacttcttcttcca
cattttccggatctcactattcgttcgaaagctatatcatggctgaaaaatgcttcgtcg
gattttctattcaatttccttcccgagttggttgaggctttgcgatttgagacatttgaa
gattcttcactggctgtgtatttattaacgctttgtgctggcgatcgccgttttgctttt
gaactttactggcagttgcaacagcgaatagaccaatgtcaggaaagaagttactcaaat
cgttgcagtttgcttcagcaacaaattcttaggctcttagatgatgaatttggtattgat
atagaaaatcagcatcgacttttacaagcgttaaatgttgcttcttgtgaaatgaaagag
gccggtgatgctagcaaaatgcaattaactcttcaacggcatcttgctttgttagatgct
cgaattctggaaaacaatgtacgacttcctcttttaccatcgtttttatgtactggtata
agtgtatcagaatgcagttacttcaattcactgacaaagccaataaaagtaacattcaaa
ggcttgaaaagttcatttgcgattctgtataaggttggcgatgatatgaggcaagatgca
ctcgtcttacaattggtgaaagtgatgaatgacatatggttgagtcaagagctcgacctc
agaatggtcattttccgctgtatttcatttgggaataaaagtggtacgaaatcatatttt
aaaggaatggtcgaactggttcctgattgccgtacactgtgcgaaattcaaagtgctgtt
ggtgctactggtgtgtttaaagacgatctgctcaaaaagtggctcgaaatgcataatcct
tcagaatttcaatataaaatagcactagagaattttcatttatcttgcgccggttggtgt
gttgccacgtatgtactcggtattggcgatcggcataatgataacatattggttactagg
acgggtcatgttttccatattgattttggcaaatatatgggtgattggcaaacggctgtt
ggattccgaagagatcgcacaccttttatttttaccagtgatatggcttacgtcatcaac
gaaggttctcctcagtcagcaacaagtcgttatcagcactttgttgataattgttgtaaa
gctttcaatttactacgaaaaaaatattcgttactcgtaaatctcatgaaaatgatgtct
tgttcgggtattgctggcatgaatttagaggctgtcaattttgtacaaagcaacttgctc
ctaaatttaactgatacccaagcaactgttcagtttacacgaatgattgaagaaagtttg
aaaagcaaatttcctcgattaaattttcttgctcatactttggtacagatgaggggtact
ccatcaatgttacgaggaggatacgatgaccccaataaactttccttcattcagcagtta
tatacaatgaaagatgacggtcgtatcactagagtcgatgtattggcgttcgagaaatgg
catataccagaaaaagtttatatgtacaaagtcgaagtaaaccgagagaacgaagcagtc
tgcggtattgtgtataggtcatttgtggaattcaatgagctctatatcaaactatgcagg
agatttccattcgcacatctgccaccactctcgcaagggacgaatgttggtcgctcaaat
atacgcaaagttgcagaaagaagacaagctgacctgcaacagttcctaaatgtgcttttt
gaatatcatcctgaggtggcaagtagtgatttggtctatacattcttccatatcattttc
cgtgatagcgcacctgacgagtcgaatcaatttttgcagctcacaaaagtagatgaggac
gacataccatcgaaaaaagtaactggccgtatctttttgagacttacttatgaccaacag
gatggaaatttgaatgtattcgttggccacgttagaggattaaagatcattaacggtcag
gcaccagattcttatgtcaaaacatatctacgtcccgacccgcaaagaagttcaaaacga
aaaacgcatgtcgttaagaatactcaaatgccaacatttaatgaggagctaaattaccaa
ttattgtctgacacgaatttggttaatcgggcactagaagtatcggtctggaactgtggt
tctttggttggcgaaaattcagtgattggtttcgtgcatattccactgcgtaaactattg
gatactccgacggatcgtaaagggattcaagttctggatggttggttcaatttgagaaca
ggttcgcgctaa

DBGET integrated database retrieval system