KEGG   Brugia malayi (filaria): Bm1_11620Help
Entry
Bm1_11620         CDS       T01050                                 

Definition
(RefSeq) Protein kinase domain containing protein
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Bm1_11620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmy01001]
    Bm1_11620
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmy03036]
    Bm1_11620
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     Bm1_11620
Protein kinases [BR:bmy01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   Bm1_11620
Chromosome and associated proteins [BR:bmy03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Bm1_11620
   Centrosome duplication proteins
    Regulators of centriole replication
     Bm1_11620
  Sister chromatid separation proteins
   Polo kinases
    Bm1_11620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Polo_box_3 Pkinase_fungal Kdo Polo_box_2 RIO1
Motif
Other DBs
NCBI-GeneID: 6097249
NCBI-ProteinID: XP_001893794
AA seq 795 aa AA seqDB search
MNRLQREYDDLEEIGRGGFGVVYRGRCVAKGKEWSGKNVAIKKIDITKAATFRVELELQA
LSRLIHDNIVKFYEQFQENGAQYIIMEYCKHRSLRDYVKQNGRLSDFSAAYILRQLVSAV
KYIHERNMIHRDISAGNVLISSIREDKLFVKLADFGLATKFRKGDIARTMLGTPGYIAPQ
VYNRHYNQKADVYSLGGILYLMLTGYDPPRDCEVNPFKETISLEGATLIQSMMDPNEERR
ISLADISMSDFMRKVDGLSLPISRSREVSKERIIYRDCQTAHISPVIVRAHSARPMASGY
KRMTKDSAFESSESGHPYRRRPSLDYHRSESVGITSCRHSTYLENQCAHCGKRQSLEKRY
GRETDVYESNGMRQSSRAKRRPALIAPVGANLKQMEGSFGDNSSKTTASLIWPIDVSRLT
PSETVRKAGRFTLQKNGTVVYEATIRDRSRSVNRNGSINDEILVKWIATVKRTTNGAQNF
SVFHQPDKCASSVNKEILPHLTDSKIHRNYHSLKQLQYKVDKVDEIALALYRRILDEIST
LGARVVKIIFKPSCDSTARLMENGDFRIKFQDGRLAILKKNAKSIVVTTNNKTPASLSNE
ERCMFECAHTDALLLETFLESAPLKTVKSFPFHFSNNSQFSINEMTETPREKILAEKQAN
HMSSERFNAPTQLQTKKCQSTDCMPMQQRRAPLRTRNVPSPRHRPQMLAEGEYILRGQFN
KNGIQVPTRIILNDPKIALELRISSNDPKVFVFKENGHEKRFCFDGISYGCVPVAARDLL
FTLCQKRLKLKASLN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtctgcaacgtgagtacgatgacctggaagaaatcggacgtggtggatttgga
gtcgtttaccgtggtcgatgtgttgccaaagggaaagaatggagcggaaaaaatgtcgca
atcaaaaagattgatatcacaaaagcggcaacgtttcgagtcgaattagagttacaagct
ttatccagacttatccatgacaatatcgtgaagttttatgagcagttccaagaaaatggt
gcgcagtatataatcatggagtattgcaaacatcggtcactacgagattacgttaaacaa
aatggaagattatctgatttttcagcggcatatattcttcgtcagttagtaagtgcagtg
aagtatatacatgaacgtaatatgatacaccgtgatatctctgccgggaacgtccttatt
tcatcgatcagagaagataaattatttgtcaaacttgctgattttggccttgcgacgaaa
ttccggaaaggtgacattgctaggacaatgcttggaactcccggatacatcgctccgcaa
gtgtataatcggcactataatcaaaaggcagatgtttattctttgggtggaatattatat
ctaatgttaactgggtatgatccgccgagagattgtgaagtgaatcctttcaaggaaaca
atttcgttagaaggtgctactctcattcaaagtatgatggatccaaatgaagaaagacgt
atttctcttgcagatatatcaatgagtgattttatgaggaaagttgatggacttagtctt
ccaataagtagatctcgagaagtatcgaaagagagaatcatttatcgtgattgtcaaact
gcgcatatttcaccggtaattgttcgagcacattcggcgagaccaatggctagtggatat
aagcgtatgactaaagattctgcatttgaaagcagcgaaagtggtcatccttatcgtcga
cgaccgtctttggattaccatcgtagcgaatcagttggtataacaagttgtcgacatagt
acctatttggaaaatcaatgcgcacactgtggtaagcgacagtcattggaaaaaaggtat
ggaagagagactgacgtatacgagtccaatggtatgcgacagtcatcacgcgcaaaacga
agacctgcgcttattgcaccagtgggtgccaatctgaagcagatggagggaagctttggt
gacaattcaagtaaaacaactgcttcactgatatggccaattgatgtgtcacgtttgacg
ccttctgagactgtacgaaaagcgggaaggtttacacttcaaaaaaatgggacagtcgtt
tacgaagcgactattcgggatcgaagccgttcagtcaatcggaacggctctataaatgat
gagatactggtaaaatggattgccacagtaaaacgaacaacaaatggagcacaaaatttt
tctgttttccatcagccagataaatgtgcttcttctgtaaataaggaaatacttcctcat
ctgactgattctaaaattcatcgtaattatcatagtttaaaacagctgcagtacaaagtc
gataaagtggatgagattgctttggcgttatatagaaggattctggatgagattagtacg
ttaggggcacgcgttgtcaagattatcttcaaaccttcatgtgatagcactgctcggtta
atggaaaatggcgattttcgaatcaaatttcaagatggacggttggctatacttaaaaaa
aatgcaaaatcaattgttgttacaacgaataataagactcccgcatctttatcaaatgaa
gaaaggtgtatgttcgaatgtgcacataccgatgcacttttgttagagacattcttggag
agcgctccattgaaaaccgtgaaatcttttccgtttcacttctcgaataacagtcaattt
agtataaacgaaatgacggaaacaccgagagaaaaaattttggcggaaaagcaagcgaat
catatgagctcggaaagattcaacgctcccactcaattacaaaccaagaagtgtcagtca
acggattgcatgccaatgcagcagcgtcgtgcaccgcttcgcacccgcaatgttccatcg
cctcgccatcgaccccaaatgcttgctgaaggagagtacatcttgcgcggtcagtttaat
aaaaatggcatacaagttccgacacgtatcattttaaatgatccaaaaattgctctcgaa
ctgcgaatatcctctaacgatccgaaagtttttgtttttaaagaaaatggtcatgagaag
aggttttgttttgatggcatcagttacggttgtgttccagtggctgctcgtgatcttctt
tttacactatgccagaaacgactgaaattgaaagcatcattaaattaa

DBGET integrated database retrieval system