KEGG   Brugia malayi (filaria): Bm1_13480Help
Entry
Bm1_13480         CDS       T01050                                 

Definition
(RefSeq) UDP-glucoronosyl and UDP-glucosyl transferase family protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00040  Pentose and glucuronate interconversions
bmy00053  Ascorbate and aldarate metabolism
bmy00830  Retinol metabolism
bmy00860  Porphyrin and chlorophyll metabolism
bmy00980  Metabolism of xenobiotics by cytochrome P450
bmy00982  Drug metabolism - cytochrome P450
bmy00983  Drug metabolism - other enzymes
bmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bm1_13480
   00053 Ascorbate and aldarate metabolism
    Bm1_13480
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Bm1_13480
   00860 Porphyrin and chlorophyll metabolism
    Bm1_13480
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Bm1_13480
   00982 Drug metabolism - cytochrome P450
    Bm1_13480
   00983 Drug metabolism - other enzymes
    Bm1_13480
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Bm1_13480
Glycosyltransferases [BR:bmy01003]
 Others
  Hydrophobic molecule
   Bm1_13480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 6097616
NCBI-ProteinID: XP_001894161
UniProt: A8P0I8
AA seq 538 aa AA seqDB search
MYHAEWYLASLIIIFHASQNDSYKILVYNPRFGKSHTKFLGSIADTLVNAGHNVTEFAPV
LFEFSDSTGSKLAKTVKIDADPEISKIMNVEIFAQDAWKRNQQSIFSLISVMKRMSDALL
KNCEFQLKQEKIMQELKSEKFDLAIFEFNQCFAGIIELLRIPAHIVVSPTALFEYAIECF
GIPNIPSYIPSLLTQYTDKMTYLQRLKNLIITILTTKLLDNHTIRCQALFRRLYGDQFID
LKEKLAQVTYVLTNTDPLFHISRPTIHKMLELGGLALPKPQPLSKEWIAVMNKRKAVVLV
SFGTVTLSCWMPNETKQALLDAFDSFPNVTFIWKYEKDEHLIAEGRPNVITSKWLPQSDL
LAHKNLIAFLTHGGMNSITETLNRGKPIVVVPLFGDQMQNAVLVQRLGLGIKLSLSELAI
KEKIKNAIYNIIYDKSYAQKVERLSKMMAKKPNQAEEQLIKHVEFAAEFGQIANFDPYGR
KMSFVSYYMLDIIIPFIILIFFIITIICYLIIRLFRKLFHKAVICNNNNSIITKVKKN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatgctgagtggtatttggcttcactcattattatatttcatgcatcacagaat
gattcatataaaatattggtatataatccacgttttggtaaaagtcacaccaaatttttg
ggttcaatcgctgatacattggttaatgccgggcataatgtaaccgagtttgctcctgta
ctttttgaattttccgattccactggttctaaattggctaaaacagtaaaaatagacgct
gatccggaaatatcgaaaataatgaacgtagaaatttttgctcaagatgcatggaaacga
aatcagcaatccattttctcattgatttcggttatgaaacgaatgtcggatgctcttctg
aagaattgtgagtttcaactaaagcaggaaaaaataatgcaagaattgaaatctgaaaag
tttgacttagctatcttcgaatttaaccaatgctttgccggaataattgaattgcttcgt
ataccggctcatattgtcgttagtcctactgctctatttgaatatgccatagaatgtttt
ggtataccaaatattcctagctatattccaagtttgcttacacagtatactgataagatg
acatatttacaacggctgaagaatctcatcataacaattttaacgactaaattgctggat
aatcatacaataagatgtcaagccttgtttcgacgactttacggcgatcaatttatcgat
ttgaaagaaaagttagctcaagtgacatatgttctcacaaatactgatccactttttcac
atctcaaggccaactattcacaaaatgttggaacttggtggtcttgccttaccaaaaccg
caaccgctaagtaaagaatggattgcagtgatgaataaacggaaagcggtagtgcttgta
tcattcggcaccgttacactgagttgttggatgcctaacgaaactaagcaagcacttcta
gatgcattcgatagttttcccaatgtgacatttatctggaagtatgaaaaagatgagcat
ttaatcgctgagggacgtccaaacgtgattacgtcaaaatggcttccacaatctgatttg
ttagcacataaaaatttgatagcatttttgacgcatggtggtatgaatagcataacggaa
actttgaatcgtggaaaacctattgttgtggtaccgctatttggtgatcagatgcagaat
gctgtattagttcaacgattaggtcttggtatcaaattatccctttcggaacttgcgata
aaagaaaaaataaaaaatgcaatttataatatcatctatgacaaaagttatgcccaaaaa
gttgaaagattatcaaaaatgatggcaaaaaagcctaatcaagctgaggaacaactcatt
aagcatgttgaatttgctgcagaatttggtcaaatagcgaatttcgacccatacggcaga
aaaatgtcatttgtatcttattatatgcttgatattatcattccttttataatacttata
ttctttatcattacaatcatttgttaccttatcattagactattcagaaaattattccac
aaagctgttatctgtaataataataatagtattataacaaaggtgaaaaaaaattaa

DBGET integrated database retrieval system