KEGG   Brugia malayi (filaria): Bm1_17110Help
Entry
Bm1_17110         CDS       T01050                                 

Definition
(RefSeq) Dedicator of cytokinesis family protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bmy  Brugia malayi (filaria)
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmy04131]
    Bm1_17110
Membrane trafficking [BR:bmy04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    Bm1_17110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
NCBI-GeneID: 6098330
NCBI-ProteinID: XP_001894879
AA seq 995 aa AA seqDB search
MSSSQANESHSAIGSAELTAEFRSRHFLIGLALADLASVLDTSNTLLHSRAIGLIRNLLS
SHELDARLLDNAVKARIASLYLPMIGIVLDASTQLHDPYSKSSNVNYDISTPISNGYTTE
MDNGPFISDKVMLAIGGMNFSPPCSPRTERKHIGLVRPSISLENTRQLLACFCWALKNME
RSSLRQWIRDLSSHRILQFLDVLQLAVSCFEFRSSFCPNQGITEITEEIKNEGSNVDDSS
VKELSRKKSRSAADSESGIRWRKETKDSQVKGSWKSCTGSSGGHSSDEPIQTDEDVILEA
TLCTEIPLIVLDTLELIIRVVSVLGSDYLFYVLSSVLKVLMHILACNQSVQTLENVFASQ
RAIVTKFPDLLFEQETEQCGELCLHLLRHCASRLPAVRSQAAASLYLLMRQSFESGASFS
KVKMQITMSLSTLVSTGTKYGDWINEDCLRHSLKTVLTYSETDASIDSQLRNTTFSEQVK
DLVFNLHMILSDTVKMKEYTNDFEMLIDLMYRVAKGYQNNPDLRLTWLINMANKHAARDN
AAEAAQCMLHAAALAAEYISMREYDVYVPKGAAAFEAISDNILEESAVSDDVISPDEEGI
CESRHFTRNGLVHLVEKTAQFMEKAQMYESMIQLYKVITPILEENRDYRHLAQVHSCLSQ
ALSRIEPTVPLIEDIADAWYSPLPSADKRCFGTYFRVGFYGSRFGDLDGVEFIYKEPAIT
KLSEISHRLDTFYTDRFGKGVLEVIKDSNTVDRNRLDSTKAYLQITYVEPYLENWERRRR
PTHFERNHRLYRFVYATPFTKDGRAHGDLKDQYKRRTVLATQYCFPYVKTRLRVVSREQI
ILTPIEVAIEDVQKRTRELAAATVQDPPDAKMLQMVLQGCIGTTVNQGPIEVANVFLTNM
ILDEHGKPMDKFQNKLRLCFKDFSKKCADALQKNRKLIQADQQAYQNELQKNYIEFTKRM
APIVGIRKTKCSEAHTLKAVHAAAVAAELGPVTAV
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaagccaagcaaatgaatcacatagtgcaattggatcagcagaactaactgct
gagtttcgttctcgacactttctaattgggcttgctcttgctgaccttgcttctgttctt
gatacatcaaatacactgcttcattcacgtgctataggccttattcgtaatttgctaagt
agccatgaattggatgctcgacttcttgataatgcggtaaaagcacgaatagcatcttta
tatttaccaatgattggtattgttttggatgcgtcaactcaattacacgatccttactcg
aaatcttccaatgttaactatgacatttccacgccaatttctaatggttacacgaccgaa
atggataatggaccatttattagcgataaagttatgcttgcaattggtggaatgaatttt
tcaccaccatgttcacctcgaaccgaacgaaaacatattggtttagtccgaccatcaatt
tcattggaaaatacacgtcaactattagcatgtttctgttgggcgttaaaaaatatggaa
cgatcatctttgcgtcaatggattcgcgatttgtcatctcatcgaattttacagtttctt
gatgttctacaacttgctgtttcatgtttcgaattcagatcatctttctgtcctaatcaa
ggtatcactgagattacagaggaaataaagaacgaaggtagtaatgttgacgattcatca
gttaaagaacttagccggaaaaaatcacgtagtgcagctgattctgaaagtggaattcgt
tggcgtaaagaaactaaagattcacaagtaaaaggttcttggaaaagttgcacaggtagt
agcggtggacactcaagcgatgaacctatccaaactgatgaagatgttatccttgaagca
actctttgcaccgagataccattaatagtgctggatacgttagaattaatcatacgtgtg
gtgtcggttctcggttctgattatctcttttatgtgttatcatctgtattaaaagtgttg
atgcatattcttgcttgcaatcaatcagtgcaaactttggaaaatgtttttgcaagtcag
cgtgcaatagttacaaagtttccagatttattatttgaacaggaaactgaacagtgtggt
gaattatgccttcatctattaagacactgtgcatctcgtttaccagctgttcgttctcag
gctgcagcttcgctatatttattgatgagacaaagcttcgaatcaggtgcaagtttctca
aaagttaagatgcaaattacgatgtcgttgagtacactggtttctacgggtaccaaatat
ggtgattggataaatgaagattgtttacgtcacagtttaaaaactgtgctaacatattca
gaaacagatgcatcaattgattctcagctacgaaatacaactttttcggagcaggtgaaa
gatctagttttcaatttacatatgatattatcggatacagtaaaaatgaaagaatataca
aatgattttgaaatgttaattgatttgatgtatcgtgtcgctaaaggataccagaacaat
ccagatcttagattgacatggttgataaatatggcaaataagcatgcagctcgagataat
gcagcagaagctgcacaatgtatgttacatgcagctgctttagctgctgaatatatttcg
atgcgtgaatatgacgtatatgtacctaaaggtgctgctgctttcgaagccataagtgat
aatattctcgaggaaagtgctgtttcggatgatgttattagtcctgatgaagaaggtatt
tgtgaaagtcgtcattttacacgaaatggcttagtacatttggtggagaagacggcacag
tttatggagaaagctcaaatgtatgaatcaatgatacaactgtataaggtaataacacca
attttggaagaaaatcgtgattatcggcatttggcacaagtacatagttgcctaagtcaa
gctctttcacgtattgagccaactgtaccgctaattgaagatatcgccgatgcatggtat
tcacctttaccaagtgctgacaaacgttgttttggcacctattttcgggtaggtttttat
ggcagtcgttttggagatttggacggtgtcgaattyatctacaaagaaccggccattaca
aaattatccgaaatcagtcatcgtttggatacattttatacagatcgttttggaaaagga
gttttggaagttattaaagattcaaatactgttgatcgaaatcgtttggattctacaaaa
gcttatttgcaaatcacatatgtggagccgtatttggagaattgggaacgtcgtcgtcgt
ccaactcatttcgagaggaatcacagattatatcgattcgtttatgcgacaccgttcacg
aaagatggtcgagctcatggtgatttgaaggatcaatacaaaagacgaactgtcctagcc
acgcagtattgtttcccttatgtgaaaacacgtcttcgggtggtgagtcgtgaacaaatc
attttgacgccaatagaagttgcaattgaagatgtccaaaaacgaactcgtgaattagcc
gctgctactgtgcaagacccaccagatgctaaaatgcttcaaatggtactgcaaggttgc
attggtaccactgtcaaccaaggtcctatagaagttgccaacgtgttccttacaaatatg
attttggatgaacatggcaagccgatggataaattccagaataagcttcgcttatgtttt
aaagacttctcaaaaaaatgtgctgatgctcttcaaaagaacagaaagcttatccaagct
gatcaacaagcttatcagaatgaactgcaaaaaaattatatcgaatttacgaaacgaatg
gcaccaattgttggcattcgtaaaactaagtgttccgaagcgcatactctaaaagctgta
catgcagctgctgttgctgcggaacttggaccggttactgcagtgtga

DBGET integrated database retrieval system