KEGG   Brugia malayi (filaria): Bm1_22710Help
Entry
Bm1_22710         CDS       T01050                                 

Definition
(RefSeq) Flavoprotein
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00770  Pantothenate and CoA biosynthesis
bmy01100  Metabolic pathways
Module
bmy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Bm1_22710
Enzymes [BR:bmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Bm1_22710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 6099447
NCBI-ProteinID: XP_001895998
UniProt: A0A1S0T0F1
AA seq 524 aa AA seqDB search
MDEPYLRKPRIVYRTGVPNPLTLDQYSAVLDKVEKNRNLVCTNGPMYRPDGGTIVVYDCA
LYPRGTLNDDQVRRTFRVDGYRWGNSKGVHNLSNGLQKRYNLLYCKNDPHGDDRFIRCEY
SREPCGLVLFHYIGDHVVAAQISDNAPHGNAKRTNQPFLRTLPIILQEVKEQSIMNNNAV
EIYDRLTEQSIYDQCASSSRVTPRRLRNKEQVRNVMKSFRQKLARNSLYINPRPTTLYVT
EQEASALGRRVLRRSNTELNRNQEVIESGVFEQEGMPDGQPPVMVKKARVEDDSESNYAP
IDVTTVDTQNIKTRVPYGPDHSFVRQGGKFHLLIGITGSVASIKLSELITELRKNSPEEK
LVIRVVATDAARTFIDESAFDVPVYNDMDEWNMWKKRGDPVLHIELRKWSDAMLIAPLDA
NSMAKIANGICDNVLLSIVRAWDPRKPLYYAPAMNVAMWENPLTYQHRKVLKELLRYKEI
PPIEKELMCGDTGLGAMATVQMIASIVASEVKNRFAVYSDNSSL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaccttacctccgaaaaccacgtatagtgtatcggactggcgtgcccaaccct
ctgacgctcgatcaatacagcgctgttctcgataaagtcgaaaaaaatcggaatttggta
tgtaccaatgggccaatgtatcgaccagatggtggtaccattgtggtatatgactgtgct
ctttatccacgtggaactttgaatgatgaccaagtacggcgcacatttcgtgttgatgga
tatcgttggggaaattccaagggtgttcataatttgagcaatggattgcaaaaacgatac
aatttactttattgcaaaaatgatccacatggcgacgatagatttatacgttgcgaatat
tcacgagagccatgcggtttggtgcttttccattatattggtgaccacgtcgtagcagct
caaatatctgataatgcaccacatggaaatgccaaacgaactaatcagccatttcttcgt
acattaccaattatattacaagaagtgaaagaacaaagtatcatgaacaataatgcagtt
gagatttatgatcgactgacggagcaaagtatttacgatcagtgcgcaagcagctcgcga
gttacaccacgtagactacgtaacaaggagcaagtgagaaacgtgatgaaatcattccgg
cagaagttagcgcgaaatagtttgtacattaatccacggccaacaaccttgtatgttacg
gaacaagaagcatcagcgcttggaagacgtgttttgcgtagatccaatacagaattaaac
agaaatcaagaagttattgaaagtggagttttcgagcaggaagggatgccggacggtcag
ccacctgtcatggtaaaaaaagctcgagttgaggatgattcggagtcgaactatgcaccg
attgatgtaacaacggttgatactcaaaacataaaaacgcgagtaccttatggaccggat
cattcattcgttcgccaaggtggtaaatttcatcttttgattggtattaccggatcagtt
gcgtcaatcaaactttctgagcttatcacggaacttcgtaagaatagtcctgaggaaaaa
ttggttattcgagtagttgcgaccgatgctgctcgaacatttattgatgagtctgcattt
gatgttcctgtttataatgatatggatgaatggaatatgtggaagaaacgtggtgatcca
gtactccatattgaattaagaaaatggtcggatgcgatgttaattgcaccattagatgct
aattcgatggctaaaatagcgaatggcatatgcgataacgtcttgctatccattgtacgc
gcatgggacccacgaaaacctctgtactatgcaccggcgatgaatgttgcaatgtgggaa
aatccactaacttatcagcatcgcaaagttttaaaagaattgttgcgatacaaggaaata
ccgccaattgagaaagaactgatgtgtggtgataccggcttaggcgctatggcaacagtg
cagatgatagcatcaattgttgctagcgaagtgaaaaatcgttttgctgtttactccgat
aattcatcactataa

DBGET integrated database retrieval system