KEGG   Brugia malayi (filaria): Bm1_32600Help
Entry
Bm1_32600         CDS       T01050                                 

Definition
(RefSeq) Tnks protein
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
bmy  Brugia malayi (filaria)
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bmy03032]
    Bm1_32600
   03036 Chromosome and associated proteins [BR:bmy03036]
    Bm1_32600
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     Bm1_32600
DNA replication proteins [BR:bmy03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     Bm1_32600
Chromosome and associated proteins [BR:bmy03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     Bm1_32600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 6101409
NCBI-ProteinID: XP_001897965
AA seq 1204 aa AA seqDB search
MTPKRAEQQRQYTQVPTVTKNNNYLDRHHEEKCLKLFESCKQGDLSILLQLLKPETVNQP
DLNNRNSSPLHYAAGFGKVDCVRALLAAGANISQADDSGLVPLHNASSFGHIEVVKILLE
SGADTNVSDHWGFTPLHEAAIWGKADVCVLLLQHGASARSENSDGKTPQDLADGDAKAVF
TGDYRKDELLEAAKNGDEESLLCCLTPFSINCHAVTGRKSTPLHLACGYNRVRTVKILLE
KGADVQAVDIGGLVPLHNASSFGHLEVVNLLLEAGADSQAEDLWNFTPLHESASKGRLEV
VRLLAASGADPTRKTGNAKAPIEYITDEDVKKDILHEYAGYKIYAAAQIGDIRMLKSLLA
ERDPNYVHPCLKETPLHAVAGSAHQRRKVIAEILLKNGCPTDVLNKDGFSALHIATKLCS
YDVLEVLISHGVNISKPSSCGKTALHIAAEKGDFDLCKQLLNYGILTDLKDNEQKTAADV
ARNIEIRDLINCWSQEKINVIQKRCRGNKSVKHCHKQREGYKYCHESRNRGSDSGGNTVS
NKIETPKVCHNVLQRETQARYSEEVLLDAARCGDLCTIKHIIGSCGTRIINCKDFNGRES
TPLHFAAGYNRVEVLKYLLRKGANVEARDTGWLVPLHNACAYGHLIVAELLVKHGANLNA
TDKWGYTPLHEAALKGKFDVCKLLIINGADPKRKGRDGKTPLDVVREGAEDVYNLLRGDA
AVLEAAKHGDIEKIRKIVIPATVNCRDVGGRFSTPLHLAAGYNNLEVARFLLENGAEVNL
KDKGGLIPLHNASSFGHLEIAALLIECGAEVNHPDKWGYTPLHEAAQKGRTQICSLLLNN
GADVTLKNSEGFTALDITVTEDTKELLMVVILIFLKPIFGSVAACWKIGVIINFPYYLKS
CFVQNAVPVDLRELPAVHVVRKTSGSAVDVPISSFVWEIMDNAVVDMQSVNCSRQETNLG
SEKEDNENETKFSMEDYLRSIGLSSLSNLFAKEKITLDVLASMTHDDLKAIGIDAFGTRF
RLLKNIGKCIRKSEGNESRNSPSNVQVPVSIGTVLVQIEPSNEVFQQIEKALNSTIVSHR
DLGLGGMYTKFEVLEVQKIINKKIYERYIRRRGDIAEENYGEHNEKLLYHGSPFVHSIVQ
KGFDERYSYMGGMFGAGIYFAEHSSKSNQYVFGMAGSGCSLHNCYERIHYLLARYTTVLP
KLKS
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaaacgagcagagcaacagcgtcagtacacacaagttccgacagtcacgaag
aacaataactacctggatcgacatcatgaagaaaaatgcttaaaactgtttgaatcatgc
aaacaaggtgacttgtcaatcttactacaattgcttaaacctgaaacagtaaatcagcct
gatctgaacaaccgcaactcatcgccgttacattatgcagccggttttgggaaggtagac
tgtgttcgagcgttacttgcagctggtgcaaacataagccaggctgatgatagtggtttg
gttccattacataatgcatcctcatttggccatattgaagtggtgaaaattttgctagaa
agtggtgctgacacaaatgttagcgatcattggggctttacaccacttcatgaagcagct
atatggggaaaagctgatgtttgcgtccttttgctgcagcatggtgcttcagcgcggagc
gaaaattcagatggtaagacaccgcaagatttagcagatggcgatgctaaagcagttttt
acaggtgactatagaaaagacgagttattagaagcagcaaagaatggagatgaggaaagc
ttactctgttgtttaacgccctttagtattaactgtcatgcagttactggtagaaagtca
acaccgttgcatttggcttgcggttataatcgagtaagaacagttaaaatcttgctagaa
aaaggtgctgatgttcaggctgtagatattggaggcttagtaccactccataatgcgtct
tcatttggacatttggaagtggtcaatttattgctggaagcaggtgctgattcacaggct
gaagatttgtggaatttcacaccgcttcatgaatctgcaagcaaaggacgtctagaggtg
gtgagattactagcagctagtggagctgatccaacacgtaaaactggcaatgcaaaggca
cccatcgaatatataactgatgaagatgttaagaaagatatacttcatgaatatgctggt
tataaaatttatgcagcagcacaaattggtgatattcgtatgttaaagagcctactagcc
gaacgagatcctaattatgtgcatccttgtctgaaagagactccactacatgcagttgca
ggctcagctcatcagagaagaaaagtaattgctgaaatacttttgaaaaacggttgtcct
acggatgtcttaaacaaagacggtttttctgcgctgcatattgcaacaaaactatgttca
tacgatgtattggaagtactgataagtcatggtgttaatattagtaaaccaagtagctgt
ggtaagacagcactccatattgcagccgaaaaaggggattttgatttgtgcaaacagctg
ttaaactatggcatattaactgatctgaaagataatgaacaaaaaacggcagctgatgtt
gcaagaaatattgaaattagagaccttatcaattgttggagccaagaaaaaataaacgtc
atacaaaaacgctgcagagggaacaaaagtgtaaaacattgtcataagcaaagagaaggc
tacaaatattgtcacgaaagccgaaatcgtggtagtgattctggaggtaatacggtatca
aataaaattgaaacaccgaaagtatgccacaatgtcttacaacgagaaacacaagcgaga
tattcagaagaagtactattggatgctgcaagatgtggtgatctttgcacgataaagcac
ataattggaagctgtggaacgagaattatcaactgtaaagattttaatggtcgtgaatca
acacccttacactttgctgctggatataatcgagtagaagtactgaagtatttgttgaga
aagggtgctaatgttgaagcaagagacacaggttggttggttccgttgcataatgcatgc
gcatacggtcacttgattgttgcagaattacttgtaaagcatggtgctaatctaaatgcc
accgataaatggggatatactcctttacacgaagctgctttgaaggggaaatttgacgtc
tgtaaacttcttattattaatggtgctgacccgaagcgcaaaggacgtgatggaaaaact
ccattggatgttgtcagagaaggagcagaagatgtatataatttgttgcgtggtgacgca
gcggtgcttgaggcagccaaacatggtgatattgaaaaaattcggaaaatcgttatccca
gcaacagtgaattgtcgcgatgttgggggacgtttttcaacgccgctgcatttggccgct
ggctataataatctggaagttgcgcgatttttgcttgaaaatggtgcagaagttaatttg
aaagataagggtggtctgataccgttgcacaatgcgagcagttttggacatctggaaatt
gccgctttgttaattgaatgtggagccgaagtgaatcatccagataaatggggttatact
cctctgcatgaagcagctcagaaaggtcgcacccaaatttgttcattacttctaaataat
ggcgcagatgttacgctgaaaaatagcgaaggttttactgcactggatattactgttacg
gaagacacaaaggaattattaatggtagtcattcttatatttttaaaacctatattcggt
tcagtagcagcttgttggaaaattggtgttattattaactttccatattatctgaagagc
tgttttgttcagaatgcagtcccggttgatctgagagaattaccagctgttcatgttgtg
cgtaaaacaagtggatcagcggttgatgtaccaatttcatcttttgtgtgggagattatg
gataatgctgttgttgacatgcaatcggtcaattgttcgagacaagaaacaaatttaggg
agtgaaaaagaagataatgaaaatgagacaaagttttctatggaagactatttacgatcg
attggtcttagttcactttcgaatttatttgctaaggaaaaaattacattagatgttttg
gccagtatgacacatgatgatttgaaagcgatcggaattgatgctttcgggactcgattt
cgattgcttaagaacattgggaaatgtataaggaaaagtgagggtaacgaaagtaggaat
tcgccgagtaatgttcaagtaccagtatcaataggtacagtgttggtacagattgagcct
tcaaatgaagtattccaacaaattgaaaaagcattgaattctacaattgtttcacaccga
gatcttggcttgggtggaatgtacaccaagtttgaagtgcttgaagtacagaagattatt
aacaaaaaaatttatgaaaggtatataagacgtcgtggagatatagcggaagaaaattat
ggtgagcataatgaaaaacttttgtatcatggatcaccgtttgtgcattccattgtacag
aaaggtttcgatgaaaggtattcatatatgggtggtatgtttggtgctggtatttatttt
gcggaacattcgagcaaaagtaatcagtatgtatttggtatggcaggcagtggatgcagt
cttcacaactgttatgaacgaattcattacctattagcgcgttatactactgttttgccg
aagttaaaaagttga

DBGET integrated database retrieval system