KEGG   Brugia malayi (filaria): Bm1_32735Help
Entry
Bm1_32735         CDS       T01050                                 

Definition
(RefSeq) putative neuropeptide receptor NPR1
  KO
K04209  neuropeptide Y receptor, invertebrate
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Bm1_32735
G protein-coupled receptors [BR:bmy04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    Bm1_32735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 6101435
NCBI-ProteinID: XP_001897991
AA seq 373 aa AA seqDB search
MYNNNNTCLDMNAELWRNRRDWSTQSFTIFIFVFFYAAIILIGIVGNLCVILAISRTRTL
QTVPNMFIFSLSCSDLVVCFTSATITPIAAFKKEWIFGAVLCSVAPFIAGASLCFSTFTL
SAISVDRFLLIYFPTRKALSRLQALIVIMVICMLSTSLSAPVIFKQRLKRFGNYCGHFCT
EEWGIDQSGRRVYGSIMLSVQFIVPLVIITFCYTAISFKLGKQRAAIKRRQRTNRMLIGM
VVAFSASWFFSVLFNVLRDYDCLPKWCQNQEYFFGIATHCIAMSSTVWNPLLYAALNLQL
RAAFFRLLPECVRQPEMQKSATYNCKPLLQSGSALRNDLTKNKILNCDHRKSCDLLAVYK
AVNRYESFEVDDI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtacaataacaataatacctgcctggatatgaacgcggaattatggcggaataggcgc
gattggagcactcagtcatttactatattcattttcgtctttttttatgcagcaattatc
ctcatcggtattgtaggcaatctatgtgtcatattggccatatctaggaccaggacactg
caaacagtacccaatatgttcattttctcattgagttgctccgaccttgttgtatgcttc
acctcagcaacaataacaccaatcgcagcattcaagaaggaatggatttttggtgctgtg
ttatgttccgtagcaccctttattgctggcgcttcattgtgcttctctacatttactctc
tcagcaatctcagtggatcgttttttgcttatctattttccaactagaaaagctttatcc
aggcttcaagcattaatcgtaattatggtaatatgcatgttatctacttcattatcagcg
ccggtaatattcaagcaaaggcttaaaagattcggcaattactgtggccatttctgtact
gaagaatggggtatcgaccaaagcggtagacgagtttatgggtcaataatgctgagcgta
caattcatcgtacctctggtgatcatcactttttgctacactgctatctctttcaaatta
ggcaagcagcgtgcagccataaaacgcagacaacgaacaaatcgtatgctaattggaatg
gtggttgcgttttctgcaagctggtttttcagcgtattatttaacgttctcagggattac
gactgtctgccgaagtggtgccaaaatcaggaatactttttcgggattgcaacacattgc
attgctatgtcctcaactgtatggaatccattgctttatgcagctctaaatttgcaatta
cgtgctgctttttttcgattactacctgaatgtgtaaggcaaccagaaatgcagaaaagt
gctacttataactgtaagcctctccttcaatccggaagtgctttgcggaatgatttaaca
aaaaataagatactgaattgtgatcacagaaaaagttgcgatctattagcagtctataaa
gcagtgaatcgatatgaaagttttgaagtagatgacatttaa

DBGET integrated database retrieval system