KEGG   Brugia malayi (filaria): Bm1_37920Help
Entry
Bm1_37920         CDS       T01050                                 

Definition
(RefSeq) Egg laying defective protein 4, isoform c
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
bmy  Brugia malayi (filaria)
Module
bmy_M00694  cGMP signaling
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Bm1_37920
Protein kinases [BR:bmy01001]
 Serine/threonine kinases: AGC group
  PKG family
   Bm1_37920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Fib_alpha Vps54_N FliD_N Lebercilin Spc29 DUF16 DUF641 TSC22 DivIC APH BORCS6 Baculo_PEP_C DUF724 ECM11 V_ATPase_I DUF1043 MCPsignal FemAB Fzo_mitofusin Atg14 ABC_tran_CTD ADIP Mnd1 CCDC106 SKA1 CorA APG6
Motif
Other DBs
NCBI-GeneID: 6102468
NCBI-ProteinID: XP_001899037
UniProt: A0A1P6C120
AA seq 737 aa AA seqDB search
MLHHSTPFIQVQIGTRTYDASEIQKLIPQLEETIEKRERQIRQQQSTVETQLKRINELEK
EVRTLQSECDKLRSVLDQKAQSVTAISVTQKASWGTEELRTELQQKAVLPTADDGVRSKK
MAVSAEPSNLDTQKAVLQHHPKSAGSKQLIRDAVQKNDFLRQLAKEQVIELVECMYEMRA
RAGQWVIQEGEPGDRLFVVAEGQLQVSREGIVLGKLSAGVVMGELAILYNCVRTASVQAL
SDVQLWVLDRSVFQMITMRLGMERHAQLMAFLSKVSLFENLSEDRISKIADVLDQDYYSG
GNYIIREGEKGDTFFILTNGQVRVTQQIEGELEPREIRILKQGDFFGEKALLGEEVRTAS
IIAINPGVEVLTLDRESFTKLIGDLEALNRDYGDSQRRATVVVPEPPSPKKTAQEKEFAD
LQLRNLKRIVTLGVGGFGRVELVCISGDKMRTFALKALKKKHIVDTRQQEHIFAERNIMM
ETHSDWIVRLYTTFRDAKYVYMLMEVCLGGELWTTLRDRGHFDDYTARFYVACVLEALEY
LHRKSIVYRDLKPENCLLTQTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKG
HDQAADYWALGIYICELMLGRPPFQAADPMKTYTLILKGVDALEIPNRRIGKTATALVKK
LCKDNPGERLGCGSGGVGDIRKHRWFMGFDWEGLRSRTLKAPIVPKVASPSDVTNFDSYP
PEQDVPPDEFSGWDEGF
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcattcgaccccatttattcaggtacaaataggcacacgcacttatgatgcc
agcgaaatccagaagcttattcctcaactggaggaaactattgaaaaaagggaacgtcaa
atccggcagcagcaaagtaccgtcgaaacgcagctgaaaaggattaacgaattagaaaag
gaagtgaggacattgcagtcagaatgtgacaaacttcgttctgtacttgatcaaaaagca
cagtccgttacggcaataagcgttactcaaaaggcttcgtggggtactgaagagttacga
actgaacttcagcaaaaggcggtgttgccaacagcggatgacggtgttcgttccaagaaa
atggcagtatctgcagaaccatccaacctagatacgcaaaaagctgtcttacaacatcat
ccgaaatctgctggttcgaaacaacttattcgggatgcagttcagaagaatgactttttg
cgacagcttgctaaagaacaagttatagaactggtagaatgcatgtatgaaatgcgtgct
cgtgcaggccaatgggttatacaggagggtgaacctggagatcgactgtttgttgttgct
gagggacagcttcaggtatcacgcgaaggtattgtgttgggaaaattgtctgcaggagtt
gttatgggagaacttgcaattctttataactgtgttagaacagcatctgtgcaagcatta
tcagatgttcagttgtgggtgctggatcgttctgtctttcaaatgattacaatgcgtttg
ggtatggaaagacatgcacagttaatggcatttcttagcaaagtatcattatttgaaaac
ttgtcagaagatcgaatatcaaaaattgctgatgttttggaccaagattattattccggt
ggtaattacattattcgagaaggagaaaaaggtgacacgttctttatccttacgaatggt
caagttcgcgttacacagcagattgaaggcgaactggagcctcgagaaatacgtattcta
aagcagggcgacttcttcggtgaaaaagcccttcttggtgaagaggtaaggacagcaagt
attatcgcaattaatccaggtgtagaagttctaacacttgacagagaatcattcacaaaa
ctgattggagatcttgaagccttaaatcgagactatggggattcacaaaggagagccact
gttgttgtacctgagccaccatcgccaaaaaagactgctcaagagaaagaatttgctgat
ttgcagttaagaaatttgaaaaggattgttacacttggtgttggtggttttggtcgtgtt
gaattggtttgcatcagtggtgacaaaatgcggacatttgcgctgaaagctttgaaaaaa
aagcatattgtagatacaaggcaacaagagcatatttttgcggaaagaaatattatgatg
gaaactcattcagactggattgttaggttatacacaacgtttcgtgatgccaaatacgtt
tatatgctgatggaagtttgtttgggtggtgagttatggactacgcttcgagatagaggg
cacttcgatgactacactgctcgattttatgtcgcttgcgttttagaggcgcttgaatat
ttacacagaaaaagcattgtttaccgtgatttaaagccagaaaactgcttacttacccag
acaggatatctgaaacttgttgacttcggtttcgcaaaaaagttagcaagtgggcgaaaa
acatggactttctgtggtacaccggaatatgtttcacccgaaattatccttaacaaggga
catgaccaagcagctgattactgggcgttaggaatttatatatgtgaattgatgctcggt
cgtccaccatttcaggccgcagatcccatgaaaacttatacattaatattgaaaggcgtg
gatgccttagaaattccaaatcgacgaattggaaaaacggcaacggctcttgttaagaaa
ctctgcaaagacaatcccggcgaacgtcttggctgtggcagtggaggcgttggtgatatt
cgtaaacataggtggtttatgggtttcgactgggaaggcttaaggtcaaggactttgaaa
gcaccaattgtaccaaaggtagcgagtccatcagatgtaacgaattttgacagctaccca
ccggaacaagacgtaccacctgatgagttttctggttgggatgaaggattctaa

DBGET integrated database retrieval system