KEGG   Brugia malayi (filaria): Bm1_39615
Entry
Bm1_39615         CDS       T01050                                 

Definition
(RefSeq) Variant SH3 domain containing protein
  KO
K04438  proto-oncogene C-crk
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04010  MAPK signaling pathway
bmy04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    Bm1_39615
   04012 ErbB signaling pathway
    Bm1_39615
SSDB
Motif
Pfam: SH3_9 SH3_2 SH3_1 SH2 hSH3
Other DBs
NCBI-GeneID: 6102807
NCBI-ProteinID: XP_001899378
UniProt: A0A0K0JNG9 A0A4E9ER09
AA seq 288 aa
MRESSSSFDPYSWRNFYFHVGREEATRLLCQSDSDLGTFLIRDSTTPGSYALSVREELSG
DQQVRHYLIEPVEADNGKMNVKIADQYFVDIPALLNHFKMRILANVSLVCPLRKTAINRM
IALYSFEGQEPADLSFEKNEILDIIEKPQEEWWEARNALGNVGLVPGNYLAQFDEVLMQR
DSPDSLVSSENRLSGASVLSDINDDVLNNAQLSETPNMPTLARVILDRRPNVYDTEALRL
KKGDLLKVTKLHPSGICEGILNGKKGTFPFTYVEFVGDTDTAATPTPV
NT seq 867 nt   +upstreamnt  +downstreamnt
atgagggagtcgtcgtcctcgttcgatccttactcttggaggaatttttatttccatgtt
ggtcgagaggaagcaacacgactattatgtcagtccgattctgatctcggcacattcctt
atccgagattctacaactccgggaagctatgctttaagcgttagagaagaactgtccggt
gatcagcaggtccgacattatctaattgagcccgttgaagcggataatggcaaaatgaat
gtgaaaatagccgatcagtactttgttgacattcctgccttgcttaaccatttcaaaatg
agaattttggcgaatgtaagtttggtgtgtccgctccgaaaaaccgcaattaataggatg
attgctttatactcatttgagggacaagagccagcggatctgtcatttgagaagaatgaa
attcttgatataatcgaaaaaccacaggaagaatggtgggaagctcgaaatgctttgggt
aatgttggccttgtccctggaaattacttggcacaatttgacgaagttctaatgcagaga
gacagtcctgattctttagtatcgtcagagaatcgtttaagcggtgcttccgttcttagt
gatattaatgacgatgttttgaacaatgcgcaactttctgaaacgccaaacatgccaaca
ctggcgcgtgtaatcctggataggcgaccaaatgtgtacgatacggaagcgttgcgtttg
aagaaaggtgatttgctgaaagtaaccaagttacatccgtccggcatttgcgaaggaatc
ttgaatggtaagaaaggtactttcccgtttacatatgtggaatttgtgggcgacacagat
acagcagcaacacctactcccgtatag

DBGET integrated database retrieval system