KEGG   Brugia malayi (filaria): Bm1_39660Help
Entry
Bm1_39660         CDS       T01050                                 

Definition
(RefSeq) map kinase activated protein kinase protein 2, isoform b
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04010  MAPK signaling pathway
bmy04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    Bm1_39660
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    Bm1_39660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmy01001]
    Bm1_39660
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bm1_39660
Protein kinases [BR:bmy01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   Bm1_39660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 6102816
NCBI-ProteinID: XP_001899387
AA seq 383 aa AA seqDB search
MGNMEASGREMDNPDAEECESASLALKATIANLSQNLMLPIHTHSVTNDYRISRQVLGVG
INGKVVECESRKTGEKFALKVLRDVPKARREVELHYAASHHKNIVRILDVYQNTYNQVKC
LLVVMECMQGGELFTRIQQRAQSAFTEREAAQVMSEICSAVAHLHSLNIAHRDIKPENLL
YSCDGPSGILKLTDFGFAKHLDSADTRPLETPCYTPYYVAPEVLGPEKYDKSCDMWSIGV
IMYILLCGFPPFFSANGLPMSPGMKNRIRTGKYAFPSPEWDRWEGFSAKDLIRKLLRTDP
SERFTIEQTMSHKWIIHYQKVPETPLFTASVLEEEKSQWMEMQDEMEMTLATMRVGNEDI
HIKSLKDSNNRLLNKRRNKINKR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatatggaagcaagcggtagagaaatggataatccagacgcagaggagtgtgag
agtgcatcacttgcattaaaagcaactattgcgaatctgtcacaaaatctgatgctgccc
atccacactcattccgttactaacgactataggattagtcgtcaagtacttggtgtggga
atcaatggaaaagtagtagaatgcgaaagtagaaaaacgggcgaaaagtttgctttaaag
gttttacgtgatgtgccaaaggcccgtcgagaagtagaacttcactacgctgctagtcac
cataaaaacatcgttcgtatattagatgtttatcaaaatacctacaatcaagtgaaatgt
ttgcttgtcgtaatggaatgtatgcaagggggtgaactcttcactcgaatacaacagaga
gcacaatcggctttcaccgaacgtgaggcagcgcaagtaatgtctgaaatctgttcagct
gttgctcatttgcactcattgaatatcgcacatagagacataaagccggaaaatttactt
tacagttgtgatgggccgtcaggtattttgaaactaaccgattttggttttgcaaaacac
ttggattctgcagataccaggccactagaaacgccttgctatacgccatattatgtcgca
ccagaagttctcggtcctgaaaagtatgacaaatcatgcgacatgtggtccataggtgtt
atcatgtatattctcttgtgtggttttccaccatttttttcggcaaatggtttacccatg
tcaccaggaatgaaaaatcgaatcaggacgggtaaatatgcttttccttcgccagaatgg
gatcggtgggaaggattttcagcaaaagatttaatcagaaagttgttgcgtactgatcct
agtgaacgtttcacgattgagcagacaatgagccataaatggatcatccactatcaaaag
gttccggaaactcccctttttactgcttcagtacttgaggaagagaaatctcaatggatg
gagatgcaagacgaaatggagatgactttagcaacgatgcgcgttggcaacgaagatatc
cacattaaaagtttaaaagattcaaataaccgtttactaaataaacggcgtaacaaaata
aacaaacggtaa

DBGET integrated database retrieval system