KEGG   Brugia malayi (filaria): Bm1_46485Help
Entry
Bm1_46485         CDS       T01050                                 

Definition
(RefSeq) MAP kinase sur-1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04010  MAPK signaling pathway
bmy04012  ErbB signaling pathway
bmy04068  FoxO signaling pathway
bmy04140  Autophagy - animal
bmy04150  mTOR signaling pathway
bmy04350  TGF-beta signaling pathway
bmy04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    Bm1_46485
   04012 ErbB signaling pathway
    Bm1_46485
   04350 TGF-beta signaling pathway
    Bm1_46485
   04068 FoxO signaling pathway
    Bm1_46485
   04150 mTOR signaling pathway
    Bm1_46485
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Bm1_46485
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Bm1_46485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmy01001]
    Bm1_46485
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmy03036]
    Bm1_46485
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmy04147]
    Bm1_46485
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Bm1_46485
Protein kinases [BR:bmy01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Bm1_46485
Chromosome and associated proteins [BR:bmy03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Bm1_46485
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bm1_46485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase Choline_kinase Kdo NDUF_B4
Motif
Other DBs
NCBI-GeneID: 6104179
NCBI-ProteinID: XP_001900759
UniProt: A0A0I9N6G9
AA seq 385 aa AA seqDB search
MTTTVEVQTKNGVEEVHGQVFEVGPRYVNLCYIGEGAYGMVVSALDTETHERVAIKKISP
FEHQTFCQRTLREIKILTKFKHENIINIQEIIRAPSVEQMKDIYIVQCLMETDLYKLLKT
QRLSNDHICYFLYQILRGLKYIHSANVIHRDLKPSNLLLNTTCDLKICDFGLARVTDPGH
DHTGVLTEYVATRWYRAPEIMLNSKGYTKSIDVWSIGCILAEMLSNRPLFPGKHYLDQLN
LILGVIGSPSQEDLQCIINEKARSYLLSLPHKIKQPWLRMYPNADPRALDLLDKMLTFNP
NKRISIEDALAHPYLEQYYDPNDEPVCEEPFTYEIEYDDLPKETLKQLIFKETEDHYRRT
QIAKKVTQLKEAELDPGINSTILSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacggtagaagtgcaaaccaaaaatggtgtcgaggaagtgcatgggcaagtt
ttcgaagttgggccacgttatgtgaatctttgctatatcggtgaaggagcatacggaatg
gtggtatcagcactggacacagagacgcatgagcgtgttgcaatcaaaaaaatctcacca
ttcgagcatcagacattctgtcagaggacgcttcgagaaatcaagattttaactaagttt
aagcatgaaaatatcatcaacattcaagaaatcatcagagcaccaagcgtggagcaaatg
aaagatatttacatagtgcaatgtttgatggaaacagatttgtacaagttgctgaaaacg
caacgactttccaatgaccatatttgttactttttataccagatattgcgtggattgaaa
tatattcattctgcgaatgttattcatcgtgatctcaagccatctaatttacttctcaac
actacttgcgatctcaaaatttgtgattttggccttgctcgagtaacagatcctggacat
gaccatactggagtattgacagaatatgtggcaactagatggtatcgtgcacctgaaatt
atgttaaattcaaaaggttatacgaaatctattgatgtgtggtcgattggttgtatctta
gccgagatgttaagtaaccgacccctttttcccggtaaacattatctggatcaattgaat
ttaatcttgggcgttattgggtcaccaagccaggaagatttacaatgcatcatcaacgag
aaggctcgatcatatttgctttcattgccacacaagataaaacaaccatggttacggatg
tatccaaatgcagatccgcgtgcactcgatttactagataagatgctaacttttaatcca
aacaaacgaatcagtatcgaagatgcccttgcacatccatatctggaacagtattatgat
cctaatgatgaacctgtctgtgaagaaccatttacttacgaaatcgagtatgacgattta
ccaaaagaaacattgaagcagctgatttttaaagaaacggaagatcattataggcgaaca
cagatagcaaagaaagtaacgcaattaaaggaagcagaattggatcctggaattaattct
acaatcttaagttcttga

DBGET integrated database retrieval system