KEGG   Brugia malayi (filaria): Bm1_51935Help
Entry
Bm1_51935         CDS       T01050                                 

Definition
(RefSeq) Glutathione S-transferase 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00480  Glutathione metabolism
bmy00980  Metabolism of xenobiotics by cytochrome P450
bmy00982  Drug metabolism - cytochrome P450
bmy00983  Drug metabolism - other enzymes
bmy01100  Metabolic pathways
bmy04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bm1_51935
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Bm1_51935
   00982 Drug metabolism - cytochrome P450
    Bm1_51935
   00983 Drug metabolism - other enzymes
    Bm1_51935
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    Bm1_51935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmy02000]
    Bm1_51935
Enzymes [BR:bmy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bm1_51935
Transporters [BR:bmy02000]
 Other transporters
  Pores ion channels [TC:1]
   Bm1_51935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_3 GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 6105272
NCBI-ProteinID: XP_001901855
UniProt: A0A0K0K140
AA seq 218 aa AA seqDB search
MLFPKFKLYSSNDQRTGTLARLMFKIANVPYEDIRISGKEQWNDIRNETALGILPILEID
DVKLSGQTAICRHLAWRFGLSGQNATCDALLDMFADLLLEAQVSIFGSANDDNNIYTNII
IIDDIKLKGVHNRVASIIEKQLTQNNTSYLIGEEITWVDLMTCTFFNSLMNYDKNVNLDR
YPLTKYMYERISQLTELENYCQQKLDANSNAVQITDCS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcccgaaatttaaactatacagttctaatgaccaacgaactggcacattagct
agactgatgtttaagattgcaaatgttccgtatgaagatataagaattagtgggaaagaa
caatggaatgacattagaaatgagactgcacttggcatactgccgatactggaaatagat
gatgtcaagttaagtggacagactgccatttgtcgtcatttggcctggaggttcggactt
tccggacaaaacgcaacatgtgacgcattgctcgatatgtttgctgatttgctccttgag
gctcaggtttcaattttcggatcagcgaatgatgataacaacatctataccaatattata
ataatcgatgatataaagcttaaaggagttcataatcgagttgcatctattatcgagaaa
caactgactcagaacaacacttcctatctgatcggagaagagattacatgggttgacttg
atgacttgcacatttttcaattcattaatgaattatgataagaatgtaaatctcgacagg
tatccattaacgaaatacatgtatgaaagaatctcacaactaacggaactggaaaactac
tgtcaacaaaaattagatgcaaacagtaatgctgtccaaataactgattgttcataa

DBGET integrated database retrieval system