KEGG   Brugia malayi (filaria): Bm1_54260Help
Entry
Bm1_54260         CDS       T01050                                 

Definition
(RefSeq) Prion-like-
  KO
K12567  titin [EC:2.7.11.1]
Organism
bmy  Brugia malayi (filaria)
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmy01001]
    Bm1_54260
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmy04131]
    Bm1_54260
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bmy04812]
    Bm1_54260
   04147 Exosome [BR:bmy04147]
    Bm1_54260
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bm1_54260
Protein kinases [BR:bmy01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Bm1_54260
Membrane trafficking [BR:bmy04131]
 Others
  Actin-binding proteins
   Others
    Bm1_54260
Cytoskeleton proteins [BR:bmy04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Bm1_54260
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bm1_54260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Titin_Ig-rpts C1-set Ig_6
Motif
Other DBs
NCBI-GeneID: 6105735
NCBI-ProteinID: XP_001902311
AA seq 2033 aa AA seqDB search
WQESNQTKQQQQRQPIRHLPQQTHYAQTAISHPQVYNQPKVYHAQYTQQQFYEQPYQISE
LPQSEEQYHDKFEEHRPFLPRPTYQQQRHQQRQQQQRQRQQLPSPAQLNSQLQYQQQYEQ
HHPYHTYFDNIEQSRYYQNMPLVERIAPQRRFTAGQDYAVQNGQAKHIGQSEKPPQFSTI
PSSTTVNAGESVTFAAKTAGQQVPSLNWYRSDGSHITTGGRYVVDILNDGSTKLTINKCT
IEDSDTYLCVAENEGGAVQLRCSLNVLEQKSSGAPQFVGKFQSVTIYEGDSLTLYCKAIG
AKLRMSWSKDGIPLKNGGSFKIDDKGNGETTLQILNAKMADGGWYQCDATNECGTSSLKG
RIVVQTRQKLDLVNQDQITLRKVDRRMARHGSKMEIDNNELREASKQPPKFLDTIKNLSL
IEGQTALLSCKYSPPDDPNLKIAWLINGKAVMTSSRLSTVAENGYAALEINPVKMFDQGE
YTIVAVNTLGEARQSAVVNIIGHRSALADASNVTLYDRSQASKVATRIAEMPNFHAELRS
MEVFDGQHVHLEAKFSPADDANVKIVWFFNGKPLKQSDNIQMSNGFGLVTLDIFNITLAE
AGNYTCQLSNEVGIMESTATVLVQPRVKDFEQRNIVDVEDAREYRLEIDASAHPPVFLTN
LSNCHCNQELGSSYFEARIAPVNDPTLKVIWLKDGQPLPNANRIQTFNNFGCVSLTLNPT
YPEDEGVYTCVLKNLRGQAQSAAQLTTLHTTNLQLESKHEQSLAQIGYLEGHQVHIGPPS
VERPEEFNSMEQPRFARQLESHIEVNENEPVHFEARIQPASDVKMVVEWYHNGAPLPAAH
RLRPMFDFGYAALDILYAFPEDSGIYTLIARNELGEVQSNLELIVNSEKSLYLDAHHPEG
LDRIQELEQSRIRPLEYPADRECDHEPRFIGDLHDLELNENENIHFALKLEPMNDPTMKV
EWYVNGRPLLISSRVRTQCEFGFLTTDIRGAIPEDSGIYAIKATNALGEGTKECRVTVKP
HATILSETQHQESLGKIHQIENLHKYGRQEVEDIGPQEPPCFTKPLPGDIGEVEEGEPLH
LECQIIPVNDNTLHVSWLKDGKPIPTGHRFRTFHDFGFVSLDILDVYAEDSGTYTCVAKN
ALGQANSSITFTCKDKERILGQTQHPSSVAKIQQIEAPKPVPQEVPDVIKEAPKFIKHIG
IGEMIYVTEGDNVYLGAQITPVDDNSLTYEWLLNGRPLMKAHRFVLTHDFGFIALNILYM
YPEDSGTYTLVVKNAAGEAQSVADIDCKAKGSMITESFHPNSVQRIRELEMPLQSPDERP
EAPRMAPRIVRTLPPQMDNIHESQTLHLEAQILPVDDNQLKVEWLHNGHPLKAGSRYRLM
NDFGFVSLDIDYVIAEDAGTYTLLVTNPEGRAETSTQFNVERLKNIYLDTEHPESLRRIQ
EIEAVQPAKPSEEELMPEKPSFIQQLSGPKEVLREGQSVHMDCMVQPINDPNLKIEWFLN
GYPIMFGSRIRTMHDFGYVGLEFLHIHPEDSGTYTCKASNAAGEATTEFFIECKPRRNIY
LDTQHADSWAKIQEIENYEPPREPSPELSFPPPTFTVPLQNFDGIFDGESVRLECRLQPV
NDPTLKVYWTKNGLPLPEGSRFMPARNLDYVTLDLLAVYGEDSGIYSCRAVSEFGEATTS
CTVTCQPTESLLLNTQHQESWNQIQDIENRRPQEPIYLEPEKIKPRFVVALPAQIGEFSE
GEPIHLEGQIEPTSDNELTVEWYQNGQPLANGHRFRKTHDFGYVSLDILYAFPEDSGEWT
CVVSNSLGDAHSTAVFKIIGKKVINSESQHPESLQRIREIEAPKEVAPEPPELKPLAPQF
IQPMEAIERIEGQPAHFETRVTPINDPKMRIQWFKDGVPLLNSNRFHHTSDFGFIGLDIS
YTVPEDAGIYTVVATNEQGQDQVEGQLYVETRSAILGDTQHESSWQKIQVLEQPKKGPEE
APESIHGSPHFTRQLNSNENLIEGQPAHFEAQYEPINDPQLAILWWVLKRNME
NT seq 6099 nt NT seq  +upstreamnt  +downstreamnt
tggcaagagagcaatcaaacgaaacagcaacaacagcgccaaccaatcagacatttaccg
cagcaaacacattacgctcaaacggcaatttctcatccacaggtttataatcaaccaaaa
gtataccacgctcagtacacgcagcagcaattttacgagcaaccatatcaaatatcagaa
ctaccacaatcagaagaacagtatcacgataaatttgaagagcatcgacctttcttacca
cgtcctacttatcagcagcagcggcatcagcagcggcagcaacagcagcggcagcggcag
cagcttccttcaccagcgcaattgaattcgcagttgcagtaccagcagcagtacgaacag
catcacccgtatcatacatattttgataatatcgaacagagccgatactatcagaatatg
cctcttgttgagcggattgcacctcagcgaaggtttacggctggtcaagattatgctgtt
caaaatggacaagcaaagcatattggtcagagtgaaaaaccaccacaatttagtaccatt
ccatcttcaacaacagtgaatgctggtgaatcagtcacatttgcagccaaaacagcaggt
cagcaagtaccaagtcttaattggtatcgctctgatggcagtcatattacaactggtggg
cgctatgtggttgacattttaaacgatggttccacaaagttgaccatcaacaaatgcaca
attgaggatagtgatacttatttgtgcgttgcagaaaatgaaggtggtgctgtacagcta
cgttgttcacttaatgttcttgaacagaaatcgagtggtgctccacagtttgttggtaaa
tttcagtctgtaacaatttacgaaggagattcgttgacactttattgcaaagcaattggt
gcgaaacttcgaatgagttggtccaaagatggtataccactgaaaaatggtggctcattt
aaaatcgatgataagggaaacggtgagacaactttacaaattcttaacgctaaaatggct
gatggtggttggtaccaatgtgatgctacaaatgaatgtggaacatcttcattgaaagga
cgcatagttgttcagactcgtcaaaaattggatttagtaaatcaggaccaaattacactg
agaaaagttgatcgtcgtatggctaggcatggtagtaaaatggaaatagataataatgaa
ttacgagaagcttccaaacaaccgccaaaatttttggatacaattaaaaatttaagtttg
attgaaggtcaaactgctttgcttagctgtaagtattcaccaccagatgatccgaattta
aaaatagcttggctaataaatggaaaggcagtgatgactagttcacgtctgtcaacagtg
gctgaaaatggttatgctgctttggaaattaatccagttaaaatgtttgatcaaggtgaa
tataccatcgtggctgtgaatacactcggtgaagcgcgacagtctgcagttgttaatatt
atagggcatcgtagtgctttagcagatgcctccaatgttacgctttatgatcggtctcaa
gctagcaaagtagctacaagaattgccgaaatgcctaatttccatgcagagctgcgatca
atggaagtttttgatggccagcatgtccatttggaagcgaaattttcaccagctgatgat
gcaaatgtaaaaattgtgtggtttttcaatgggaaaccattgaaacaaagtgataatata
caaatgtctaatggttttggattggttacgctagatattttcaacattacactagcagaa
gctggcaattatacatgtcagttgtcaaatgaagtgggtattatggaatcaacagctacc
gtacttgttcagcctcgtgtaaaagatttcgaacagagaaatatagtagatgtggaagat
gcccgtgaatatcgacttgaaattgatgcttcagctcatccaccagtcttccttacaaat
ctatcaaattgtcactgcaatcaagagcttggcagttcatattttgaagcacgtattgca
cccgtaaatgatcctacattgaaagtaatttggctgaaagatggacaacctctgccaaat
gctaacagaatccaaacattcaataattttggttgcgtatccttaacattgaatccgaca
tatccagaagatgaaggcgtttatacttgcgttctgaagaatttacgtggccaagctcaa
agtgcagctcagctcactacactgcacactaccaatttgcaacttgaatctaagcatgaa
caatcattagctcagatcggatatcttgagggacatcaggttcacattgggccaccatcc
gtggaaagaccggaagaatttaacagtatggaacaaccacgttttgcacgtcaattagaa
agccacattgaagtaaatgaaaatgaaccagtgcatttcgaagcacggatccaacccgca
agtgacgtgaaaatggttgttgaatggtaccacaatggcgcacctttaccagcagcacac
agactgagaccaatgttcgattttggttatgctgctctggatattctgtatgcattccct
gaggattctgggatctatacattgattgccaggaatgaactaggtgaagtgcaatcaaac
ctcgaattgatcgtcaattcggagaaatctctttatctggatgcccatcatccggaagga
ctcgatcggattcaggagttggaacaaagtcgcattcgtccactggaatatccagctgac
cgtgaatgtgatcatgagccgcgattcatcggtgatttgcatgatttggagttgaacgaa
aacgaaaatattcactttgctttaaagttggaaccgatgaatgatcctacgatgaaagta
gaatggtacgttaatggacgtccacttttgattagttctcgtgtccgaactcaatgtgaa
ttcggttttttaacgactgatattcgtggggctattccggaagattctggaatttatgcc
ataaaagcaacaaatgcgctgggtgaaggaacaaaggaatgcagagtaaccgtaaaacca
catgcaactatactttctgagacgcaacatcaagaaagtttgggcaaaatccatcaaatc
gagaatttacataagtatggtcgacaggaagtggaggatataggccctcaggaaccgcca
tgcttcacaaaaccattacctggcgatattggtgaagtggaagagggagagccacttcat
ctggaatgtcaaataattccagtaaatgataacacattacacgttagctggttaaaggat
gggaagccaattcccacaggacatagattccgtaccttccatgattttggtttcgtttct
ttggatattttggatgtctatgctgaagattcgggaacatacacgtgtgttgcaaagaat
gcgctcggacaagcgaactcatccattactttcacatgcaaggataaagaacggattctt
ggtcaaacacagcatccgagcagtgttgctaaaattcaacaaattgaagcaccaaagccg
gtcccacaagaagttccggacgtaataaaagaagcaccaaaattcatcaagcatattggt
atcggtgaaatgatatatgttactgaaggtgacaatgtttatctgggagcacaaatcact
cctgttgatgataattccttaacgtatgaatggcttttaaatggcaggccgttaatgaaa
gcacaccgttttgtgcttactcatgatttcgggtttattgcactcaatattttatacatg
tatccagaagatagtggtacttatactctggttgtgaaaaatgcagctggtgaagcacag
tctgttgctgatattgactgtaaagctaaaggaagcatgataactgaatccttccatcct
aattcagtacaacgtattcgtgaactagaaatgccgttacaatcaccggatgaacgcccg
gaagcacctcgaatggcaccacggattgtacgaactctaccaccacaaatggataatatc
catgaaagtcaaacacttcatttagaagcacaaattctacctgtcgatgataatcaactc
aaggttgaatggcttcataacggacacccattgaaagctggtagccgttatcgcttgatg
aatgatttcggcttcgtatctctggacattgattatgttatcgcagaagatgctgggaca
tatacattgcttgtcacaaatccagagggtcgtgctgagacaagcacacaatttaatgtg
gaacgattgaaaaatatttatttggacaccgaacaccctgaaagcttacgacggatccag
gaaattgaagcagtacaaccagcaaaaccatctgaagaagaattaatgcctgaaaagcca
tctttcattcagcaattgagcggtcctaaagaagtccttagagaaggacaatcagtgcac
atggattgcatggtgcaaccaattaatgaccctaatttaaagattgaatggttccttaat
ggttatccaattatgtttggatcacgcattcgaactatgcatgacttcggctacgtaggc
cttgagttcctacatattcatcctgaagattcgggtacttacacatgcaaagctagtaat
gcagctggtgaagcaactactgaatttttcatcgaatgcaaaccacgaagaaatatctat
cttgatactcagcatgcagattcatgggcgaaaatccaggagatagaaaattatgaacca
ccacgtgaaccatcgcctgaactttcgtttccaccaccaactttcactgtaccattacaa
aatttcgatggtatctttgacggtgaaagtgttagattagaatgtagactgcaaccagtt
aatgatccgacactgaaagtatattggaccaaaaatggattaccgttgccggaaggaagt
cgtttcatgcctgcacgtaatttggattatgttactttggatctgttggctgtgtatggc
gaagattccggaatctattcatgccgagcagttagtgaatttggagaagcaacaacttca
tgtaccgttacatgccaaccaacggaatcactgcttttgaatactcagcatcaagagtct
tggaatcaaattcaagatatagaaaaccgtcgtccccaagaaccgatttaccttgaacct
gaaaaaataaagccaagatttgttgtggctttgcctgcgcaaattggtgaattcagtgaa
ggcgaacccattcatctggaaggacagatagaaccaacgagcgataatgaactcacggta
gagtggtatcaaaacggtcaaccgctcgcaaatggacatcgtttccggaaaacgcacgat
tttggatatgtttcgttggacattctctatgcttttcctgaagatagtggcgaatggaca
tgtgtagtcagtaatagtttgggagatgcacactcaacagcagtgtttaaaattatcggc
aagaaagtaatcaacagtgaaagccaacatccagaaagtttgcaaagaattcgagaaatc
gaagcaccaaaagaagtagcaccagaaccacccgaattaaagcctttggcacctcagttc
atacaaccgatggaagccatcgaaaggatcgaaggccaaccagcccactttgaaacgagg
gtaacaccaattaacgatccaaagatgagaatacagtggttcaaagatggtgttcctcta
ttaaacagtaatcgattccatcatacatctgattttggatttatcggattggatatttca
tatactgttccggaagatgctggtatatatacggttgtagcaacaaacgaacaaggacag
gaccaagtagaagggcagctttatgttgagaccagatcagccattcttggcgatacgcag
catgagagtagctggcaaaagattcaagtattggaacagccgaaaaaagggcctgaagag
gctccagaatctattcacgggtcacctcattttactcgacaattaaattctaatgaaaat
cttattgagggacaaccagcgcacttcgaggcacaatatgaacctattaatgatccacag
ctagcaattttatggtgggttttgaaaaggaatatggaa

DBGET integrated database retrieval system