KEGG   Bacillus pseudomycoides 219298: DJ92_1359Help
Entry
DJ92_1359         CDS       T03239                                 

Definition
(GenBank) homocysteine S-methyltransferase family protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00270  Cysteine and methionine metabolism
bmyc00670  One carbon pool by folate
bmyc01100  Metabolic pathways
bmyc01110  Biosynthesis of secondary metabolites
bmyc01120  Microbial metabolism in diverse environments
bmyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DJ92_1359
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DJ92_1359
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     DJ92_1359
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     DJ92_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: AIK37104
Position
complement(1271054..1272886)
Genome map
AA seq 610 aa AA seqDB search
MKILDLVSKGIVIGDGAIGTLLHSHGLQSSFEELNLSDPDLIISIHKQYVAAGADIIQTN
TYGANEAKLRMYGLENQVTQINKAAVKLAKAAVTDKNAILGTIGGMKHIGAVTTTDMERE
FMLLEQAGALLEEKVDGLLLETFYDEFELLHAVKVLRKQTDIPIIAQLALHEAGATQNGN
DVNGILTQLLDYGANVVGLNCQLGPLHMTEAFKMISIPKNGYLSAYPNAGLPNYVEGRYV
YEGSPAYFEEMTPKFIEQGIRLLGGCCGTTPAHIEGMKRVIANVTPVTEKQIVQRQQVVH
IQTKRASTHVTLAEKAKKQTTVVVELDPPKTLDTQRFFEGARALKRAGADAITLADNSLA
SPRISNMAMGALLTKHDIPVLTHLTCRDHNVIGLQSHLLGLSALGMEEVLALTGDPARVG
DFPGATSVYDLSSIELIKMIKEMNDGRSILGKSIGPATRFSVGGAFNPHVRHLKAAVKRM
ERKIAAGAEYFLTQPIYDVALIEEIYEATKHLEKPIFIGIMPLVSKRNADFLHFEVPGIT
VPEEVRQRMDGHETQESAIEEGIRISQELINAAMKYFNGIYLITPFLKYEITENLVKYVK
EKRDVKEGIN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctagatttagtatcaaaaggaattgttatcggtgatggcgcaattggtacg
ttattacattctcatggtttgcaaagtagttttgaagaattaaacttatctgatccagat
cttattatatctattcataaacaatatgtagctgctggggcagatattattcaaacaaat
acatatggtgcaaatgaagcgaaattacgcatgtatggtttggaaaatcaggtcacccaa
attaataaagcagcggttaaacttgcaaaagcagccgtaacagataagaacgccatttta
gggaccatcggtgggatgaagcatatcggggccgttacaacgactgatatggaacgagag
tttatgctacttgagcaagcgggagcattattagaagaaaaggttgacggattattatta
gaaacattttatgatgagttcgaattgttacatgcagtgaaagtattgcgaaaacaaaca
gatattccaattattgcacagctagcgcttcatgaagcgggcgcaacgcaaaatggaaat
gatgtaaatggaatattaacgcagcttttagattacggtgcaaatgtagtcggtttaaac
tgtcagttaggaccgcttcatatgacggaagcttttaaaatgatatcgattcctaaaaat
ggttatttgtcggcttatccaaatgcaggccttccaaactatgtagaaggacgttacgta
tacgaaggaagccctgcttattttgaagagatgacaccgaaatttattgaacaaggtatt
cgtttgttagggggctgttgtggtacaacgccagcacatattgaagggatgaagcgtgta
attgcgaatgtaacgcctgttacagaaaaacaaattgttcaaagacaacaagtagttcat
atccaaacaaaacgtgctagcactcatgttacccttgcagaaaaagcgaagaagcaaaca
acggtggttgttgaactagatcccccaaaaacattagatacgcagcgtttttttgaaggg
gcaagggcattgaaaagagcgggagcagatgccattacgttagcagataattcgttagca
tccccgcgcatttcaaacatggcaatgggggcattattaacgaagcatgatattccagta
ctgacgcatttaacgtgccgtgatcataatgtcattggtttgcaatctcatttactaggt
ttatcggctttaggaatggaagaagtgttagctttaacaggtgatccagcgcgagtgggg
gattttcctggagcgacttctgtatatgatttgtcttctattgaattaattaaaatgatt
aaagaaatgaatgatggtcgatctattttaggaaaatccattggtccagcgacaaggttt
tctgttggaggagcttttaatccgcacgtgagacatttaaaagcagcggtgaagcgaatg
gagaggaaaattgcagctggtgcagagtatttcttaacacagccaatttacgatgtagcc
ttaattgaagaaatatacgaggcgacaaaacatttagaaaaaccaatttttattggaatt
atgcctttagtaagtaaacgtaatgctgattttcttcattttgaggtgccaggcattaca
gtgcctgaggaagtaagacagagaatggatgggcatgaaacgcaggagtctgcaattgaa
gaaggaattcgtatttctcaggaattaattaatgccgcaatgaaatactttaacggtatt
tatctcattacgccatttttgaaatatgaaattacagaaaatctcgttaagtatgtgaaa
gaaaagcgagacgtgaaagagggaatcaactga

DBGET integrated database retrieval system