KEGG   Bacillus pseudomycoides 219298: DJ92_1371Help
Entry
DJ92_1371         CDS       T03239                                 

Definition
(GenBank) nucleotidyl transferase family protein
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00051  Fructose and mannose metabolism
bmyc00520  Amino sugar and nucleotide sugar metabolism
bmyc01100  Metabolic pathways
bmyc01110  Biosynthesis of secondary metabolites
bmyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DJ92_1371
   00520 Amino sugar and nucleotide sugar metabolism
    DJ92_1371
Enzymes [BR:bmyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DJ92_1371
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     DJ92_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep PGM_PMM_I Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AIK35741
UniProt: A0A2B5VGW1
Position
complement(1281724..1284078)
Genome map
AA seq 784 aa AA seqDB search
MKGVILAGGKGRRLRPLTCNLPKPMLPLLEKPVIEYNIELLRQHGIHEIAITVQYMSTAI
RRYFGDGSKWGVKLQYFEDSPPLGTAGSIKQAEAFLDEPFVVISGDALTDFNLSKGIEFH
QCRNRLVTMFVKEVENPLSFGSVVMNREHEIIRYMEKPSWNEVISNIVNTGIYIMDPEIF
SYISSAQFFDFSHHVFPLLENKKALFGYVAQGYWLDIGTLDQYRQAHFDLLTKKVQVPIS
YTEVLPMVWMGEGVTIEKGTKIHGPSFIGEGVSIGAGVIIEPYSIIGKCSTILDHTHVQK
SIVLAHTYVGKRCELLEATVGENAMIKDDVTLFEKSVVADRCQIGKNTVIQHNGKIWPNK
VVDSHSIIASSGITENEKNSGWLQKSRVVGRGNIEMTPQVVVKIAMAYGSLFSKGERILI
GGYDDVKVDIFKKLFLHAIHSVGLYTMECQEMNDSAFRYAINELECAGGIFIRFEQEEGI
VIQLYGKEGIRLSYKQQKEMEHLYMSEAFHYVYDKDMGRNETVHVCLEKYVESVLVYLDI
ETIQKQTFHLLINKRDEMFQSLLISFLRKLGCTITWVYASEQKEHVKLLMKSSRAHMALM
LYEQGNKFELYDNHGGIYQSANCEEIDVPDLLLETTESVYPLSLKLGECYLLFYMYGEQS
KFQMRWQQDILYRIGKLFELIARQGNTLSTMLEQSPPLYLLCDEVVCSWKEKGKVMGMLL
QDMEKREVEVLEGIQFKYTEKEWSYIVSDAKHPKFLVYSHARNPVIAKENMKTLIEKIRQ
YQKV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggttattttagctggaggaaaaggaaggcgtcttagaccgttaacatgtaat
cttccaaagccaatgttaccattacttgaaaaaccagtgatagaatacaatattgagtta
ctaaggcagcatggtattcatgagattgcaattacagttcaatatatgagtacggcaatt
aggcggtattttggtgatggaagtaaatggggagtgaagttgcaatatttcgaagattcg
ccgccgcttggtacggcaggaagcattaaacaagcagaagcgtttttagatgagccattt
gttgtaattagtggagatgcattgacggattttaatttatcgaaaggaattgaattccat
caatgcaggaatagactggtcacaatgtttgtgaaggaagtggaaaacccactatcattt
ggttcagtcgttatgaatagagagcatgaaattatacgttacatggaaaaaccgagttgg
aacgaagtgatttcaaatattgtaaatacaggcatttatattatggaccccgaaattttt
tcttatatttcatcagcgcagttttttgattttagtcaccatgtctttcctttgctggaa
aataaaaaagcactctttggatatgtagcgcaaggctactggttagatattggtacatta
gatcaatatcggcaggctcattttgacttacttacaaagaaagtacaggtacccatttct
tatacggaagtactaccgatggtttggatgggagaaggggtaactattgaaaagggaaca
aaaattcacggtccatcttttatcggagaaggagtgtccatcggagcgggggtaataatt
gagccatattcaattatcggtaagtgcagcacaatattagatcatacgcatgtccaaaaa
agtattgttcttgcccatacgtatgtaggaaaacgctgtgagctattagaagcgaccgtt
ggagaaaatgcgatgattaaagatgatgtaactttatttgagaaaagtgtggtagcagac
cgttgccagattggaaaaaatacagtgatacaacacaatgggaaaatatggcctaataaa
gttgttgatagtcattctattattgcctcgtcaggaattactgaaaatgaaaaaaactca
ggttggctgcaaaaaagccgggtagtaggtaggggtaatatagaaatgacacctcaagtt
gttgtaaaaatagcaatggcatatggctctcttttttcaaaaggggagcgtatattgata
gggggatatgatgatgtaaaagttgatatttttaaaaagttatttctacatgcaattcat
agtgttggcttgtatacgatggaatgtcaagaaatgaacgattcggcctttcggtatgcg
atcaatgaactcgaatgtgcagggggcatttttattcgctttgaacaagaagaaggaatt
gtcattcaactgtatggtaaggaaggcataaggttatcgtataaacagcaaaaagaaatg
gaacacttgtatatgtcagaagcatttcattatgtatatgataaagacatgggacgaaat
gaaacggtacatgtttgtttagagaaatatgttgaatctgtattagtgtatttggatatc
gaaacgatacaaaagcaaacatttcaccttcttattaataaaagagatgaaatgtttcag
tccctactcatatccttcttgcgaaaactaggttgcacaattacatgggtttatgctagt
gagcaaaaagaacatgttaaattgttaatgaaatcaagtagagctcatatggctcttatg
ttgtatgaacaaggaaataaatttgaattatatgataatcatggtgggatttaccaaagt
gcaaattgtgaagaaatcgatgtgcctgatttattacttgagacgacagaaagtgtttat
ccattatcgttaaaattaggagagtgctatcttcttttttatatgtatggtgaacaaagt
aagtttcagatgagatggcagcaagatattttatatcggattggaaaattattcgaacta
attgctcggcaaggaaatactttgtcgacgatgttagagcaatcaccacccctttactta
ttatgtgatgaagttgtttgctcgtggaaagagaaagggaaagtaatgggaatgttattg
caagatatggaaaaaagagaagtcgaagtattagagggaatccaatttaaatatacagaa
aaagagtggtcatatattgtttctgatgcaaaacatcctaaatttcttgtatattcacac
gcgagaaacccagtaatagcaaaggaaaatatgaaaactcttatagaaaaaattagacaa
tatcaaaaggtgtag

DBGET integrated database retrieval system