KEGG   Bacillus pseudomycoides 219298: DJ92_2053Help
Entry
DJ92_2053         CDS       T03239                                 

Definition
(GenBank) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00627  Aminobenzoate degradation
bmyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DJ92_2053
Enzymes [BR:bmyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     DJ92_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Isochorismatase Acid_phosphat_B DUF4332
Motif
Other DBs
NCBI-ProteinID: AIK40412
UniProt: A0A1S9WUY7
Position
complement(1927637..1928401)
Genome map
AA seq 254 aa AA seqDB search
MYKGYLIDLDGTMYRGEEQIEEASDFVKALQERGIPYLFVTNNSTRKPEQVAEKLVRFDI
PAKPEQVFTTSMATANFIYERKQDASVYMIGEEGLHDALVEKGFKLVDENPDFVVVGLDR
EITYEKLAKACLAVRNGATFISTNGDIAIPTERGLLPGNGSLTSVVTVSTGVEPIFIGKP
ESIIMEQALKVLGMAKEEALMVGDNYDTDILAGINAGMHTLLVHTGVTTVEKLTEYDVQP
TQVVHNLTEWIEKM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggctatttaatcgacttagatggtacaatgtatcgcggtgaagaacaaatt
gaagaagcaagcgactttgtaaaagcactacaggagcgcggcattccctatttgtttgta
acgaataactcaacgcgtaaaccagagcaagtggcagaaaagcttgttcgtttcgatatt
ccagctaaaccagagcaagtatttacaacaagcatggcaacagcaaactttatttatgag
cgtaaacaagatgcgtctgtgtatatgattggtgaagaaggattgcatgacgcacttgta
gaaaaaggattcaaacttgtggatgaaaatcctgactttgtcgttgttggattagatcgc
gaaattacatatgaaaagctagcgaaagcatgtcttgcagtacgtaatggtgcgacattt
atttcaacaaatggagatattgccattccaactgagcgtggtttattacctggaaacggt
tccttaacatctgttgtaacagtgtcaacaggtgtagagccaatctttatcggaaaacca
gaatccattattatggaacaagcactaaaagtacttggcatggcgaaagaagaagcgcta
atggttggggataactatgatactgacattttagcggggataaatgctggtatgcataca
cttcttgtccacactggagtcacaactgtggagaagttaacagagtatgacgtgcagcca
acacaagttgtgcataacttgacagagtggattgagaagatgtaa

DBGET integrated database retrieval system