KEGG   Bacillus pseudomycoides 219298: DJ92_2438Help
Entry
DJ92_2438         CDS       T03239                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00071  Fatty acid degradation
bmyc00072  Synthesis and degradation of ketone bodies
bmyc00280  Valine, leucine and isoleucine degradation
bmyc00310  Lysine degradation
bmyc00362  Benzoate degradation
bmyc00380  Tryptophan metabolism
bmyc00620  Pyruvate metabolism
bmyc00630  Glyoxylate and dicarboxylate metabolism
bmyc00640  Propanoate metabolism
bmyc00650  Butanoate metabolism
bmyc00900  Terpenoid backbone biosynthesis
bmyc01100  Metabolic pathways
bmyc01110  Biosynthesis of secondary metabolites
bmyc01120  Microbial metabolism in diverse environments
bmyc01130  Biosynthesis of antibiotics
bmyc01200  Carbon metabolism
bmyc01212  Fatty acid metabolism
bmyc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DJ92_2438
   00630 Glyoxylate and dicarboxylate metabolism
    DJ92_2438
   00640 Propanoate metabolism
    DJ92_2438
   00650 Butanoate metabolism
    DJ92_2438
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DJ92_2438
   00072 Synthesis and degradation of ketone bodies
    DJ92_2438
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DJ92_2438
   00310 Lysine degradation
    DJ92_2438
   00380 Tryptophan metabolism
    DJ92_2438
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DJ92_2438
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DJ92_2438
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DJ92_2438
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmyc04147]
    DJ92_2438
Enzymes [BR:bmyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DJ92_2438
Exosome [BR:bmyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DJ92_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIK38147
UniProt: A0A076WAK3
Position
complement(2318615..2319796)
Genome map
AA seq 393 aa AA seqDB search
MVRTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERADVAANDVEEVIFGAVIQGG
QGQIPSRQAAREAGLPWETRTETVNKVCASGLRAVTMADQIIRTGDQTLIVAGGMESMSN
SPYILQGARWGYRMGHNQVADLNVVDGLTCSFSGVHMGVYGGEVAKEDGISREVQDEWAY
RSHQRAVSAQKEGRFEEEIVPVSVPQRKGEPIVVTKDEAPREDTTVEKLAKLKPVFDKTA
AVTAGNAPGLNDGGAALVLMSEDRAQQEGRKPLATILAHTAIAVEAKDFPRTPGYAINEL
LKKTGKTVDEIDLFEINEAFAAVAIASANIAGIDPEKINVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAIMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagaacagttattttaagtgctgcaagaacgccggttggaaagtttgggggatct
ttaaaggatgtaaaagcaacggaacttggaggaattgcgattaaagctgcgcttgagcga
gcggatgttgctgcaaatgatgttgaagaagttatattcggagcggtgattcaaggagga
caggggcaaattccttcgcgccaagcggcgagagaagctggacttccctgggaaactcgt
acagaaacagtgaataaagtttgtgcatctggtcttcgtgctgtaacaatggctgatcaa
attattcgtactggagatcaaacgcttattgtagcaggcggaatggaatcaatgagcaat
agtccttatattttacaaggtgcacgatggggataccggatgggacataatcaagttgcc
gatctaaatgtagtagatggcttaacgtgttcattttctggcgtacatatgggtgtgtat
ggcggagaagtcgcgaaggaggacggaatctctcgcgaagtgcaagatgaatgggcatat
cgtagtcatcagcgtgcagtttctgcgcagaaggaaggtcgatttgaagaggaaatcgta
ccagtatctgtaccgcagcgaaaaggtgagccgattgttgttacaaaagatgaagcgccg
cgcgaagatacaacagttgaaaagctagcaaagctaaagcctgtatttgataaaacagcg
gcagtaacggctggaaatgcaccagggttaaatgatggcggcgcggcgcttgtattaatg
agcgaggacagagcgcagcaagaaggaagaaaaccgttagcgacgattttagcacataca
gcaattgcggtagaagcgaaagatttcccaagaacaccagggtatgcgattaatgagctt
ttgaagaaaacaggtaagacagtggatgagattgacttatttgagattaacgaagccttt
gcagcagttgcaattgcgagtgcaaatattgcaggaattgatccggaaaaaattaacgta
aacggtggcgcggttgcgatgggacatccaattggagcaagcggggcacggattattgta
acgcttattcatgcattgaagcaacgcggcggcggcattggaattgcatcgatttgcagc
ggcggtggccaaggcgacgcgattatgattgaagttcattaa

DBGET integrated database retrieval system