KEGG   Bacillus pseudomycoides 219298: DJ92_329Help
Entry
DJ92_329          CDS       T03239                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00020  Citrate cycle (TCA cycle)
bmyc00620  Pyruvate metabolism
bmyc01100  Metabolic pathways
bmyc01110  Biosynthesis of secondary metabolites
bmyc01120  Microbial metabolism in diverse environments
bmyc01130  Biosynthesis of antibiotics
bmyc01200  Carbon metabolism
Module
bmyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmyc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DJ92_329 (mqo)
   00620 Pyruvate metabolism
    DJ92_329 (mqo)
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     DJ92_329 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIK37923
Position
complement(302158..303660)
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELVPEWEIKVFEKLANAGEESSNEWNNAGTGHA
ALCELNYTSEKSDGSIDIRKAIKINEQFQLSRQFWSYLVNSNLIRNPQDFIMPIPHMSMV
QGEENVTFLKKRFEALSNSPLFQGMEFSDDHEKLEEWMPLIMEGRTSNEPIAATKIDSGT
DVNFGALTRMLFDHLQSKNVEINYKHSVENIKRASDGSWEVKVHDMNSSKIEYHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCNNPEVAAQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKTLLFGPFAGFSPKFLKTGSNFDLIGSVKPNNVLTMMAAGVKEMSLTKY
LIQQVMLSNEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPQHMKEWELKIKEMIPSYGVSLAENPELFQ
EIHTSTAQTLDLSQKELVYS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgccggaatcatgagcgcg
actttgggatcattactgaaagagttagtacctgaatgggaaatcaaagtgttcgagaaa
ctcgcaaacgcaggagaagaaagttctaacgaatggaataatgcgggaacgggccacgct
gcactttgtgaactgaactatacatccgaaaaatctgatggatctatagatattcgtaaa
gctatcaaaattaatgaacagtttcagctttcaagacaattttggtcttatcttgtaaat
agtaatctgattcgtaacccgcaagactttatcatgccaatacctcatatgagtatggtg
caaggggaagaaaatgtaacgtttttgaaaaaacgttttgaagcgctttcaaacagtccg
ctgtttcaaggaatggaattttctgatgaccatgaaaagctggaggagtggatgccactt
attatggaagggcgtacatcgaatgagccaatagcggcaacgaaaatcgattctggaacg
gatgtcaactttggtgctttaacacgtatgttgtttgaccacttgcagagtaaaaatgtc
gaaataaactacaaacatagtgtcgagaatattaaacgtgctagcgacggatcatgggaa
gtgaaagtgcatgatatgaatagtagtaaaatcgaataccatactgcaaaattcgtcttt
atcggcggtgggggcggaagtctgcctttactacaaaaaaccggtattcctgagtcaaaa
catattggagggttcccggtaagcggattatttatggtatgtaacaatccggaagttgca
gcgcagcaccatgcaaaagtatacggtaaggctaaggttggtgctccgccaatgtctgtt
ccgcatcttgatacaagatatattgacaacaaaaaaacattgctgtttggaccgtttgcc
ggcttctcaccaaagttcttaaaaactggttcgaattttgatttgataggttccgtaaaa
ccgaataatgtcctcactatgatggcggcaggcgtaaaagagatgtcattgacaaaatac
ttgatccagcaagttatgttatcgaatgaaaagcgcatggaagaattacgcgagtttatt
ccgaacgccaaaagcgaggattgggatatagtggtagcgggacaacgtgtgcaagttatc
aaagatactgatgccggtggtaaaggaacacttcaatttggtacggaagttgttagtgcc
gctgatggctcgatagctgcattgctcggcgcttccccgggtgcttctaccgctgttcac
gttatgcttgaggtattagaaaaatgcttcccacaacatatgaaagagtgggaactgaaa
ataaaagaaatgattccttcttatggcgtgtcactagcggaaaacccagagcttttccaa
gagattcatacttcaacagcgcagacgcttgatctaagccaaaaagaactagtttacagt
taa

DBGET integrated database retrieval system