KEGG   Bacillus pseudomycoides 219298: DJ92_3932Help
Entry
DJ92_3932         CDS       T03239                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00010  Glycolysis / Gluconeogenesis
bmyc00053  Ascorbate and aldarate metabolism
bmyc00071  Fatty acid degradation
bmyc00280  Valine, leucine and isoleucine degradation
bmyc00310  Lysine degradation
bmyc00330  Arginine and proline metabolism
bmyc00340  Histidine metabolism
bmyc00380  Tryptophan metabolism
bmyc00410  beta-Alanine metabolism
bmyc00561  Glycerolipid metabolism
bmyc00620  Pyruvate metabolism
bmyc00625  Chloroalkane and chloroalkene degradation
bmyc01100  Metabolic pathways
bmyc01110  Biosynthesis of secondary metabolites
bmyc01120  Microbial metabolism in diverse environments
bmyc01130  Biosynthesis of antibiotics
Module
bmyc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DJ92_3932
   00053 Ascorbate and aldarate metabolism
    DJ92_3932
   00620 Pyruvate metabolism
    DJ92_3932
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DJ92_3932
   00561 Glycerolipid metabolism
    DJ92_3932
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DJ92_3932
   00310 Lysine degradation
    DJ92_3932
   00330 Arginine and proline metabolism
    DJ92_3932
   00340 Histidine metabolism
    DJ92_3932
   00380 Tryptophan metabolism
    DJ92_3932
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DJ92_3932
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DJ92_3932
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DJ92_3932
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DJ92_3932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIK40327
Position
3843157..3844524
Genome map
AA seq 455 aa AA seqDB search
MDITSIVNEQKSYFYKGHTRNIEERKQHLKRLYEGIQRFESDIFQALKLDLNKSDHESFT
TEVGYVLKEISFLVKHLSSWSKPKRVRTALTHVGSKGKVVPEPYGVTLVMAPWNYPFQLA
VAPLVGAIAAGNTVVLKPSELTPNVSSLLANMLQELFPAELVAVVEGGIEESTALLKEPF
DYIFFTGSVGVGKIVMEAAAKSLIPLTLELGGKSPCIVHNDAKLEIAARRIVWGKFLNAG
QTCVAPDYIYVHSSVKEQFIEALRIEIKNQYGEKPLQNENYVRIVSKRHFERLCSFLQDG
RVEIGGKYNEETLHIEPSIITNITWQDSVMEDEIFGPILPIIEYEKIEDIMERIQRQPKS
LALYVFSESKEIQRQITRNVSYGGGCINDVVYHLATPYLPFGGVGSSGLGSYHGKQSFRT
FSHYKSILSQSTVFDMKIRYSSTKSALKFIRKLLK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggatatcacttctattgtgaacgagcaaaagtcatatttttataaaggtcacacaaga
aatatagaagaaagaaagcaacatttaaaaagattatatgaagggattcagcgttttgaa
tctgatatttttcaagcgttaaaattggatctaaataaatcagatcatgaatcatttacg
acagaggttggatacgtattaaaggaaatttcatttttagtgaaacatctttcttcatgg
agtaagccgaagcgcgttcgtaccgcacttacacatgttggttcgaaaggaaaagtggtt
ccagagccttatggtgttacccttgtaatggctccgtggaattatccctttcaacttgcg
gttgcaccccttgtaggggcaatagccgctggaaacacggttgtattaaagccgtcagaa
ttgacacctaatgtttctagtcttcttgcaaatatgttacaagagttatttccggctgaa
cttgttgcggttgttgaaggcggtattgaggagagtacagcactgttaaaagagccgttt
gattatatttttttcaccggtagcgttggagtgggtaaaattgttatggaggcggcagct
aaaagtttgattccccttacgttagagcttggtggaaagagcccatgtattgtgcataat
gatgcaaagttagaaatagcagcaaggcgcatagtttgggggaaattcttgaatgcggga
caaacatgtgttgcacctgattacatatatgttcattcttctgtaaaagaacaatttatt
gaagcactacgaattgaaattaaaaatcaatatggcgaaaaaccactgcaaaatgaaaat
tacgttcggattgtcagtaaacgtcattttgaaagattatgttctttcttacaagatggt
agggttgaaattggtgggaaatataatgaggaaactctgcatattgagcctagtattata
acgaatattacatggcaggattccgttatggaagatgaaattttcggtccaattttgccg
attatagagtatgagaaaatagaagacattatggaaagaattcagcgacaacctaaatca
ttagctttatatgtattttcagagagtaaagaaattcaaagacaaattacacgtaatgtc
tcatatggcggtgggtgtataaatgacgttgtatatcatcttgctacgccatatctaccc
tttggtggtgttgggagcagtggattaggaagttatcatggaaaacaaagttttcgcaca
ttttcacactataaaagcattttatcccaatctacagtatttgatatgaaaattcgttat
tcttctacaaaaagtgctttaaaattcatacgaaagttgttaaaatga

DBGET integrated database retrieval system