KEGG   Bacillus pseudomycoides 219298: DJ92_4030Help
Entry
DJ92_4030         CDS       T03239                                 

Definition
(GenBank) phosphotransferase enzyme family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bmyc  Bacillus pseudomycoides 219298
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bmyc01504]
    DJ92_4030
Enzymes [BR:bmyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     DJ92_4030
Antimicrobial resistance genes [BR:bmyc01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    DJ92_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH
Motif
Other DBs
NCBI-ProteinID: AIK39141
Position
complement(3933915..3934823)
Genome map
AA seq 302 aa AA seqDB search
MTSYMRDIQQSLPNIPIHSYEQNDNGWDNVAIIINNEWLFRFPRKSQYAKRIPREKELCE
ILAQSLQEIKVPKYHILYKNELDSLPFCSYYKLIHGEPLTVQTIERLTVKERETVISQLA
IFLASLHTIPIEHAVKWGFDTEKSISYWRQIQTKLHVHLACTLTLLEKKAFDCLFEDFFE
HMYASNFQKTMIHADFTHHHILFDGEKRSIAGIIDFGDAQIGDPAFDFAGLYNNFGSEFT
NAIYKRYCTLTPHHDLSFFKRVIQFYQYSPLLHNLVYNFETNNEQEIQKNRKHLQTILQG
RS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttatatgcgagatatccagcaatcactacccaatattcctatacactcttat
gaacaaaacgataatggctgggataatgtagccattatcattaacaatgaatggctcttc
cgttttccacgtaaatcccagtatgcaaaacgaatacctcgcgaaaaagaactatgcgaa
atacttgctcaatcgttacaagagataaaggtcccaaaataccacatcttatataaaaat
gaattagattcacttccattttgtagttattataaactcattcatggggagccattaaca
gtacaaacaatagaaagattaactgtaaaagaacgtgaaacagttatctcgcagcttgct
atctttctcgcttctttacataccatcccaatagaacatgctgtaaaatgggggtttgat
actgagaaatctatctcatattggcgacagattcaaacgaaattacacgttcatcttgct
tgcacacttacattgttagaaaaaaaagcttttgattgtttattcgaggatttttttgaa
catatgtatgcatctaatttccaaaaaacaatgatccacgctgactttacacatcatcac
attttatttgatggggagaaaagaagcattgctggtattatcgattttggtgatgctcaa
attggagatcctgcctttgacttcgctggattatataacaattttggtagtgaatttaca
aatgccatatataaacggtactgtactctcactccccatcatgatttatctttctttaag
cgtgtcattcaattttatcagtatagtccattactccataaccttgtttataactttgaa
acaaataacgaacaggagatacagaagaatcgaaaacatttacaaactatacttcaggga
aggagttaa

DBGET integrated database retrieval system