KEGG   Bacillus mycoides ATCC 6462: BG05_1840Help
Entry
BG05_1840         CDS       T03798                                 

Gene name
dxs
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00730  Thiamine metabolism
bmyo00900  Terpenoid backbone biosynthesis
bmyo01100  Metabolic pathways
bmyo01110  Biosynthesis of secondary metabolites
bmyo01130  Biosynthesis of antibiotics
Module
bmyo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BG05_1840 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG05_1840 (dxs)
Enzymes [BR:bmyo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     BG05_1840 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C Transketolase_N E1_dh PFOR_II
Motif
Other DBs
NCBI-ProteinID: AJH21747
UniProt: A0A084J368
Position
1744185..1746077
Genome map
AA seq 630 aa AA seqDB search
MDLTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFD
SPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLS
AAMGMALARDLKKTEEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPN
VGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFE
ELGFTYLGPVDGHDYEKLFETLQYAKKTKGPVLVHVITKKGKGYKPAESDVIGTWHGTGS
YKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRM
IDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGL
VGADGETHQGVFDIAFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLG
VQMDEELKAIPIGTWETLKEGTQAAILTFGTTIPMAMEAAERLEQAGISVKVVNARFIKP
MDEAYLHELLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALIERMGIPDRFIEHGS
VTKLLEEIGLTTDAVVDRIHTMIPSKQKRA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
gtggatctaacgcaaattcaaaaccctagttttttgaaagatatgtctatcagtgaacta
gaggggttgagtgaggatattcgtaagtttttaattgaagagctctctcaaacaggtgga
catattgcacctaatttaggtgtagtagaactcacaattgctctgcataaattatttgat
agtccgaaagataagtttttatgggacgtaggacatcaatcctatgtacataaaatttta
acagggcgtgcgaaagaattcggcacattaaggcaataccaaggtctatgtggttttcca
aaacgctgtgagagtgagcatgatgtttgggaaactggtcatagttcaacgtcgttatct
gctgcaatgggaatggctctagcacgtgatttaaagaaaacggaagaatacgttatacca
atcattggcgatggtgcattaacaggcggaatggctttagaggcattgaaccacattggg
catgaaaaaacggacatgattgttattttgaatgacaatgaaatgtcaattgcaccaaac
gtcggtgcacttcataatgtacttggtcgtttacgtaccgcagggaagtaccattgggta
aaagatgaactagagtatatattgaagaaaatcccagcagtcggcgggaaagttgctgcg
acagcagagaaaataaaagatagtctaaaatatttactagtatcaggcgtcttttttgaa
gaattaggctttacatatttaggtccggtcgatgggcatgattatgaaaagttattcgaa
acgttgcaatatgcaaagaaaacaaaaggcccagtacttgttcatgttattacgaaaaaa
ggaaaaggttataaaccagctgaaagtgacgttattggaacttggcatggaacaggatcg
tataaaattgagtcaggtgacttcgttaaaccgaaagaagttgcaccagcatggagtgct
gttgttagtgaaacagtgcttaagctagcgagaacggatgaacgtatcgttgcaattacg
cctgcaatgcctgttggatcgaaacttgagaaattccaaaaagaatttccggatcgcatg
attgatgtaggtattgcagagcagcatgctacaacaatggcagctggtatggcaacacaa
gggatgaagccgttcttagcaatttattcaacatttttacaaagagcatatgaccaagtt
gttcatgatatttgtcgccagaatttaaacgtttttattggaatagatcgctctggatta
gtaggagcagacggtgaaacgcatcaaggtgtatttgacatcgcgtttttacgtcacttg
ccgaatatggtgcttatgatgccgaaagatgaaaatgaaggtcaacatttagtatataca
gcgatgcaatacgaagatgggccgattgctttacgttatgcacgcggaaatggacttggc
gttcaaatggatgaagaattaaaggcgattccaatcggtacatgggaaacgttaaaagaa
ggcacacaagcagcaattttaacgtttggtacgacaatcccgatggcaatggaagcagct
gagcgtcttgaacaagctggaatatcagtgaaagtagtgaatgctcgctttattaagccg
atggacgaagcatatttacatgagcttttagggaaaaatataccgattttaacgattgaa
gaggcttgtttaatcggtggctttggaacgggagtagttgaatttgcttctgagaacgga
taccatagtgctttaattgaacgaatgggtattcctgatcgcttcatagagcatggtagt
gtaacaaaactgttagaagaaattggtttaacaacagatgctgttgtagaccgtattcat
acaatgattccatcaaaacaaaaaagggcgtaa

DBGET integrated database retrieval system