KEGG   Bacillus mycoides ATCC 6462: BG05_2404Help
Entry
BG05_2404         CDS       T03798                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00071  Fatty acid degradation
bmyo00072  Synthesis and degradation of ketone bodies
bmyo00280  Valine, leucine and isoleucine degradation
bmyo00310  Lysine degradation
bmyo00362  Benzoate degradation
bmyo00380  Tryptophan metabolism
bmyo00620  Pyruvate metabolism
bmyo00630  Glyoxylate and dicarboxylate metabolism
bmyo00640  Propanoate metabolism
bmyo00650  Butanoate metabolism
bmyo00900  Terpenoid backbone biosynthesis
bmyo01100  Metabolic pathways
bmyo01110  Biosynthesis of secondary metabolites
bmyo01120  Microbial metabolism in diverse environments
bmyo01130  Biosynthesis of antibiotics
bmyo01200  Carbon metabolism
bmyo01212  Fatty acid metabolism
bmyo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG05_2404
   00630 Glyoxylate and dicarboxylate metabolism
    BG05_2404
   00640 Propanoate metabolism
    BG05_2404
   00650 Butanoate metabolism
    BG05_2404
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG05_2404
   00072 Synthesis and degradation of ketone bodies
    BG05_2404
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG05_2404
   00310 Lysine degradation
    BG05_2404
   00380 Tryptophan metabolism
    BG05_2404
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG05_2404
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG05_2404
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG05_2404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmyo04147]
    BG05_2404
Enzymes [BR:bmyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG05_2404
Exosome [BR:bmyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG05_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJH20968
UniProt: A0A0B5SFF6
Position
2294608..2295705
Genome map
AA seq 365 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGIEREIDDVILGNVVGPGGNV
ARLSALEAGLGYHIPGVTIDRQCGAGLEAIRTACHFIQGDAGNCYIAGGVESTSTSPFQN
RARFSPETIGDPDMGLAAEYVAGQYNITKEIQDEYACLSYKRTLQALEKGYIQEEILPHY
FNGLLDESIKREMNYERMIKRTKPVFLQNGTVTAGNSCGVNDGACAVLVMEEGQAQKLGY
KPVLRFVRSAVVGVDPNLPGTGPIFAVNKLLNEMNMKVEDIDYFEINEAFASKIVACAKE
LQIPFEKLNVNGGAIALGHPYGASGAMLVTRLFYQAQREHMKYGITTLGIGGGIGLALLF
EKVEN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggcggttattgtagaagcgaaaagaacacctattggtaaaaaaaacgggatg
ttgaaagattatgaagttcagcaattagcagcaccacttcttacgtttttaagtaaagga
attgagagagaaatagacgatgttatattagggaatgttgttggaccgggaggtaatgtt
gcaagattatctgctttagaagctgggcttggttatcatatacctggtgtaacgattgac
cggcaatgcggagctggattggaagcaattcgtactgcgtgtcattttattcaaggggat
gcaggtaattgttatattgctgggggcgtagagagtacaagtacgtcaccttttcaaaat
agagcgcggttttcacctgaaacaattggggatccagatatgggattggcggctgagtat
gttgcagggcaatataacataacaaaagagatacaagatgaatatgcttgtcttagctat
aaaagaacgctgcaagcattagaaaaaggatatatacaagaagagatattacctcattat
tttaatggattattagatgaatctataaagcgggaaatgaattatgaaagaatgattaag
agaacgaaacctgtatttttacaaaatggaacggtaacagcaggtaattcgtgcggtgta
aatgatggagcatgtgctgttcttgtaatggaagaggggcaagcacagaaattagggtac
aagccagttcttcgtttcgttcgtagtgctgtagttggcgtggatccaaatcttccaggg
actggtccgatatttgcggtgaacaaattattaaacgaaatgaatatgaaagtagaggac
atcgattattttgaaataaatgaagcatttgcttcaaaaattgttgcttgtgcaaaggag
ttacaaattccttttgaaaaattaaatgtaaatggtggagcaattgcgctcggtcatccg
tacggtgcatctggagctatgcttgtgacacgtttgttttatcaagcacaaagagagcat
atgaaatatggaattacgacgttaggaattggtggtggaatagggcttgcgctattattt
gagaaagtagaaaactag

DBGET integrated database retrieval system