KEGG   Bacillus mycoides ATCC 6462: BG05_2669Help
Entry
BG05_2669         CDS       T03798                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00361  Chlorocyclohexane and chlorobenzene degradation
bmyo00625  Chloroalkane and chloroalkene degradation
bmyo01100  Metabolic pathways
bmyo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BG05_2669
   00361 Chlorocyclohexane and chlorobenzene degradation
    BG05_2669
Enzymes [BR:bmyo01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BG05_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AJH17586
UniProt: A0A0B5RWZ2
Position
2558471..2559181
Genome map
AA seq 236 aa AA seqDB search
MKYKVILFDVDDTLLDFPETERNALHNAFVQFGMPTGYNDYLASYKEISNGLWRDLENKM
ITLSELAVDRFRQLFALHNIEVDAQHFSDVYLENLGKEVHLIDGAVKLCENLQDCKLGII
TNGYTKVQQSRIGNSPLCNFFDHIIISEEVGHQKPAREIFDYAFEKFGITDKSSVLMVGD
SLTSDMKGGEDYGIDTCWYNPSLKENTAGVKPTYEVESLLQILEIAEVAEEKVASF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaagtaatactattcgacgtagacgatacattattagatttccctgaaaca
gaaagaaacgcattacataacgcgtttgtacaatttggcatgcctacaggatataatgat
tatcttgcaagttataaagagattagtaatggattatggagagatttagagaataaaatg
attacgctaagtgaattagcggtagatcgatttagacaattatttgctcttcataatata
gaagtagacgcgcagcattttagtgacgtataccttgaaaacttaggaaaagaagtacat
cttatagatggtgcagtgaaactatgtgagaatcttcaagattgtaagttaggtatcatt
acgaatggatatacaaaagtgcaacaatctagaattggaaattcgcctttatgtaacttc
tttgatcatattattatttctgaagaagtcggccatcaaaaaccagcgcgtgagattttt
gattatgcttttgagaagtttgggattactgataaatcaagtgtactaatggttggagat
tcgctaacttctgatatgaaaggcggagaagattacggtattgatacgtgttggtataat
ccgagtctgaaagaaaatacggcaggtgttaagccgacctatgaagtggagagcctgcta
caaattttagaaattgcggaagtggcggaagaaaaggtagcttcattttaa

DBGET integrated database retrieval system