KEGG   Bacillus mycoides ATCC 6462: BG05_3304Help
Entry
BG05_3304         CDS       T03798                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00730  Thiamine metabolism
bmyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BG05_3304 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmyo03000]
    BG05_3304 (tenA)
Enzymes [BR:bmyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BG05_3304 (tenA)
Transcription factors [BR:bmyo03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BG05_3304 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 TPR_MLP1_2 Paramyxo_C
Motif
Other DBs
NCBI-ProteinID: AJH21935
UniProt: A0A084J1X0
Position
3144808..3145494
Genome map
AA seq 228 aa AA seqDB search
MTFSQSLRKEVDSIWEASFNHPFVKKLGEGTLDLASFRYYVLQDSYYLSHFARVQTLGAA
KALELETTARMAHHAQNTYEAELSLHENFAKKLGITKEEKDNFIPAPTAYAYTSHMYRAA
YEGHLGDIIAAILPCYWLYYEIGERLKECQPEEPIYQEWISAYGSDWFRTLVEEQITRLD
TIAEKVTEADRNRMRQHFIFSSQYEYSFWEMAYTLEKWPVNEEVKGVI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgactttttcacaatcattacgtaaagaagtagattcaatttgggaagcaagttttaac
catccttttgtaaaaaaactaggcgaaggaacattagatttagctagttttcgatattat
gtgcttcaagattcttattatttgagtcattttgctagagtacaaacgttaggtgctgca
aaggctcttgaattagaaacgacagctcgtatggcacaccatgcacaaaatacgtatgaa
gctgagttatcattacatgagaatttcgcaaagaaattagggattacaaaagaagaaaaa
gataattttattcctgcgccaactgcatatgcatatacatctcatatgtatcgtgcagct
tatgaagggcatttaggagatattattgcggctattttaccttgttattggttatattat
gaaatcggtgaacgattaaaagaatgtcaaccagaagagccaatttatcaagaatggatt
tctgcatatggatctgattggttccgtactctagtagaagagcaaatcacacgattagat
acgatcgctgaaaaagtaacagaggcagaccgtaatcgtatgagacaacattttattttt
agtagtcaatatgaatattcattttgggaaatggcatatacattagaaaaatggccggtg
aatgaagaagttaaaggtgttatttaa

DBGET integrated database retrieval system