KEGG   Bacillus mycoides ATCC 6462: BG05_4514Help
Entry
BG05_4514         CDS       T03798                                 

Definition
(GenBank) phosphotransferase enzyme family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bmyo  Bacillus mycoides ATCC 6462
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bmyo01504]
    BG05_4514
Enzymes [BR:bmyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BG05_4514
Antimicrobial resistance genes [BR:bmyo01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BG05_4514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH
Motif
Other DBs
NCBI-ProteinID: AJH18336
UniProt: A0A0B5RZ44
Position
4371096..4372004
Genome map
AA seq 302 aa AA seqDB search
MDSYKQYIKEALPGLSIHSYKQNEEGWDNITVIINDELLFRFPRKLEYANRIPLEKELCT
ILSHLLQEIEIPKYHLLYKNNCNTVPFCSFYPLIHGEPLTTELVAKLEKKELKAIITQLA
TFLAALHSIPLKRTETLGFPIEKTLTYWKELQTKLNQYFTNSLTSLQKSALNRLFENFFI
CIAKSTFQNTIIHADFTHHHILFNNLNKTISGVIDFGDAQIGDPAFDFAGLYYDFGREFT
TSVYEQYSALISYRDPLLIHRITTFYQYSPLLHNLIYNIETNNEIILKKNEEQLKAILQG
RD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacaatatataaaagaagctctgcccggtctttctatacattcatat
aaacaaaatgaagaaggatgggataatataacggttattataaatgacgaactactattt
cgtttcccgcgaaaacttgaatatgcaaaccgaattccgttagaaaaagaactgtgcaca
attctttctcatttattacaagaaatcgagattcctaagtatcatttattgtataagaat
aattgtaataccgttccattttgtagcttttatcctctcattcatggtgaaccgttaaca
actgaactagttgcaaagctagagaaaaaagaattgaaagcaatcattacacaattagcc
actttccttgcggctttacatagtattcctttaaaacgtactgaaacgctagggttccct
atcgaaaaaacacttacctactggaaagaactacaaacaaaattaaatcaatattttact
aacagtcttacttcattacagaaatcagccttaaatcgtttattcgaaaatttttttatc
tgtatagctaaatctacctttcaaaatacaatcatccatgctgactttacacatcatcac
attttatttaacaacttgaacaaaaccatttcaggtgttatcgattttggagatgctcaa
attggcgatcccgcttttgattttgctgggctatattatgatttcggtcgtgagtttact
acatctgtatatgaacaatacagtgcacttatttcttaccgcgatccattactcattcac
cgcatcactaccttttatcaatacagccctttactacataaccttatttataacattgaa
acaaacaacgaaataatattaaagaagaatgaagaacagcttaaagcaatactacaggga
cgagattaa

DBGET integrated database retrieval system