KEGG   Brucella melitensis M28: BM28_A1527Help
Entry
BM28_A1527        CDS       T01852                                 

Definition
(GenBank) protein PetR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bmz  Brucella melitensis M28
Pathway
bmz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BM28_A1527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmz02022]
    BM28_A1527
Two-component system [BR:bmz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BM28_A1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADZ66603
Position
1:1493174..1493899
Genome map
AA seq 241 aa AA seqDB search
MGSKDAMAAEEEKTLSDDAPHLLVVDDDTRIRSLLSQYLTNSGFRVTMAGSAAEARRKLE
GIDFDLLILDVMMPGETGVSLTRSLREQKNVPILMLTALSETDSRIDGLAAGADDYLPKP
FDPRELTLRINNILRRGAPPAQPKIEQIVFGPYTFFIPRRELKKGTETIKLTDREQDIMA
IFAERAGETIPRHELTGQDGDVGERTIDVQINRLRRKIEQDPANPVWLQTVRGIGYKLSI
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgaaagacgccatggctgcagaagaagaaaagacgctatcggacgacgcaccg
caccttctcgtcgtggacgacgatacgcgcatccgcagccttctctcacaatatttgacc
aatagcgggtttcgcgtcacgatggctggcagtgcagccgaagcgcgccgcaagctggaa
ggcatcgacttcgaccttctgattctcgacgtgatgatgccgggagaaaccggcgtttcg
ctgacgcgctccttgcgcgaacagaagaacgtgccgattctcatgctgacagccctgtcg
gaaaccgacagccgcatcgacggcctggctgccggagcagacgactatctgcccaaaccc
tttgatccgcgcgaactgacactgcgtatcaacaatatcctgcgccgtggcgcaccgccc
gcgcagccgaagatcgaacagatcgtgttcggcccttatacttttttcattccgcgtcgc
gaattgaagaagggaaccgagacgatcaagctcaccgaccgcgagcaggatatcatggcg
atctttgccgagcgggcgggcgaaaccatcccccgccatgaactgaccgggcaggacggc
gatgtgggtgaacgcacgatcgatgtgcagatcaaccgtctgcgccgaaagatcgagcag
gatcccgcaaacccggtctggctccagaccgtgcgcggcatcggctacaaactcagcatc
gaatag

DBGET integrated database retrieval system