KEGG   Brucella melitensis M28: BM28_A1623Help
Entry
BM28_A1623        CDS       T01852                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bmz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BM28_A1623
Enzymes [BR:bmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BM28_A1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N AdoHcyase_NAD F420_oxidored 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADZ66699
Position
1:1585670..1586464
Genome map
AA seq 264 aa AA seqDB search
MAYDAFAEFRMTGHNVIITGGAQNIGAGIAKTLSGAGAKVMIADLNGDKARQTAAAIQKE
TGNECHGMKCDVTSLSDIEQVVRETVSAFGGISTLVNNVGWGGRHEDPTAITEEDFIAAY
KLNTISAYRMSMACLPHLLKSQNATITNSGSFSSAVPAYDILAYGTAKAALNQMMVSLAH
MLAKKVRINSVLIGTVMTEGYGSAGIDEEMQEKLRHPDNLTGRAGRPEDIANTMLWLCSP
ASGWVSGQTINVHGGGGVTRLFGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgatgcatttgccgaatttcgcatgacgggccacaatgtcatcatcaccggc
ggcgcacagaatataggcgcaggcattgcgaaaaccctgtcaggcgcaggcgcaaaggtg
atgatcgccgacctcaacggcgacaaggccaggcaaacggcggcagcaatccagaaagaa
accggcaatgaatgccatggcatgaagtgcgacgtcacttcacttagcgatatcgaacag
gtggtgcgcgaaaccgtctcggcttttggcggcatttcaaccctcgtcaacaatgtcggc
tggggcgggcgccatgaagacccgacagcgatcaccgaggaagatttcatcgcagcctat
aagctgaatacgatcagcgcctaccgcatgagcatggcttgcctgccgcatctgcttaaa
tcgcaaaacgcgacgatcaccaattccggctctttctcctctgctgtgccagcctatgac
attctggcctatggaacggcgaaagctgccctcaaccagatgatggtttcgctggctcat
atgctggcaaagaaggtgcgcatcaattccgtgctgatcggcacggtgatgacagaaggt
tacggttcagccggcatcgacgaggaaatgcaggaaaagctgcgccatcccgataacctt
accgggcgtgccggacgacccgaagatatcgccaataccatgttgtggctgtgctcgccc
gccagcggatgggtcagcggccagactatcaatgtgcatggcggcggcggcgtcacgcgc
ctcttcggcaggtga

DBGET integrated database retrieval system