KEGG   Brucella melitensis M28: BM28_A2093Help
Entry
BM28_A2093        CDS       T01852                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00260  Glycine, serine and threonine metabolism
bmz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01130  Biosynthesis of antibiotics
bmz01230  Biosynthesis of amino acids
Module
bmz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BM28_A2093 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BM28_A2093 (trpA)
Enzymes [BR:bmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BM28_A2093 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG DUF561 Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADZ67169
Position
1:complement(2052231..2053070)
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETALKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLYMAAKFRKEDDTTPIVMMGYYNLIYIYGVERFLTDAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGAAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDEKGKVKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgccgaactgaaggccgagggccgtccggcgctc
gttacctatttcatgggcggcgatcccgatctggaaaccgcgctgaaggtgatgaaagcc
ctgccgaaagccggcgctgacgtgatcgagcttggtatgcccttctccgacccgatggcg
gatggacccgccattcaggcggctggccttcgcgccctgaacgccggacagacgctggcg
aagacgctttatatggcagcaaaattccgcaaggaagacgatacgaccccgatcgtcatg
atgggctattacaatctgatctatatctatggcgtggagcgttttctgaccgatgccaag
gcatccggcgtggatgggctgatcgttgtcgatcttccttccgaaatggatgccgagctt
tgcattccggcaatgaaggcgggcatcaatttcatccgcctcaccacgccgaccacggac
gacaagcgcctgccgaaagtgctgcataattcatcgggctttgtctattatgtctcgatg
aacggcatcaccggcgcggccattgccgatacggcaaaggtcggcgaagcggttcgccat
atcaagaaaagcaccgacctgccgatctgtgtcggtttcggcgtcaagacgccggaacag
gctgcggcaatcgcaacccatgccgatggcgtcgtcgtgggcacggccattgtcaacgca
attgccggtgaactcgatgaaaagggcaaggtgaagggtgatccggttgccgccgcaacc
cggcttgtccacgctcttgcagagagtgtgcgcgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system