KEGG   Brucella melitensis M28: BM28_B0864Help
Entry
BM28_B0864        CDS       T01852                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00220  Arginine biosynthesis
bmz00330  Arginine and proline metabolism
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01130  Biosynthesis of antibiotics
bmz01230  Biosynthesis of amino acids
Module
bmz_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bmz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BM28_B0864
   00330 Arginine and proline metabolism
    BM28_B0864
Enzymes [BR:bmz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BM28_B0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADZ68113
Position
2:complement(860045..860965)
Genome map
AA seq 306 aa AA seqDB search
MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTDLGNLAPAAQRPLQHPN
HAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGTVPGIARRAAEKGRKQFVL
WLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKLAAPIDPHNVCMLGIRSVDPA
EREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFLDERGRTAAVMVDLMASLLGRSVMD
RPTISY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtaagattctggggctgcccgttcaggaaggcactggccgcaagggctgtaat
atggggcctgattcctatcgtgcggccgggattgccgatgccataagggaacttgggcac
gagtgcacagatttgggcaatctggcgcctgccgcccagcgcccgctacagcatccgaac
catgcaatcaaggcgcttccatatgccgttgcctggatcgaagcgatcagcgaagcggcc
tatcgcgaaagtgcggaagggttcccgatctttcttggtggcgatcaccttctggcagcg
ggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgcaagcaattcgtgctc
tggctcgatgcgcatacggatttccatacgctggaaaccacgaccagcggcaatcttcat
ggtacgcccgttgcttattataccggtcagaagggctttgagggctatttccccaagctt
gcagcgccgatcgatccgcataatgtctgcatgttgggcattcgcagcgtcgatccggct
gagcgggaagcggtcaagaaaacagaagttatcgtctatgacatgcggctgatcgacgag
catggtgttgccgccctgctgcgccggtttctggagcgcgtgaaggcggaagacgggctg
ttgcatgtgagccttgatgtcgattttctcgatccctccatcgcgccggccgtgggtacg
acggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatggagatgctgcacgac
agcgggctggtgacgagcctcgatctcgttgaactcaatccctttcttgatgagcgcggc
cgcacggccgccgtcatggtggacctgatggcgagccttctgggccgcagcgtcatggac
cgcccgaccatcagctattga

DBGET integrated database retrieval system