KEGG   Brassica napus (rape): 106345896Help
Entry
106345896         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106345896
   00500 Starch and sucrose metabolism
    106345896
   00520 Amino sugar and nucleotide sugar metabolism
    106345896
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106345896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106345896
NCBI-ProteinID: XP_013640561
AA seq 343 aa AA seqDB search
MGENAISGNLKNLKIDTGRSETLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANV
AVGVSRLGGSSAFVGKVGDDEFGRMLADILRLNNVDNSGMRFDHKARTALTFVTLRGDGE
REFLFFRHPSADMRLLESELDKNLIQKAKIFHYGSIGLIEEPCRSTQLAAMKIAKASGSL
LSYDPNLRLPLWPSEEAARKEIMSIWNLADVIKISEEEITFLTGGDDPYDDEVVLRKLFH
PNLKLLVVSEGPNGCRYYTQEFKGRVGGVKVKAVDTTGAGDAFVSGLLNSLASDLTLLTD
EKKLREALLFANACGAITATERGAIPAMPTMDAVQDLLSSSRS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaacgccatctcaggtaatctcaagaatctaaagatcgacacaggacgttca
gagactctcgtggtgtgtttcggcgagatgctgatcgatttcgtgccaacggtgggaggt
gtttcactcgctgaagcaccagctttcaagaaagcaccaggaggtgcacctgcgaatgta
gccgttggtgtctctagactcggtggctcctctgctttcgttggaaaggtaggtgatgat
gagtttggacgaatgttagctgatattctaaggctgaacaacgtggataactccgggatg
agattcgaccacaaagcacgcaccgctctcacctttgttacgttgagaggtgacggagag
agggagtttctgttcttcagacaccctagtgccgacatgcgtctcttggagtctgagctt
gacaagaatctaatccaaaaggccaagatctttcattacggatctatcggtttgatcgag
gagccttgccggtcgactcagctcgcagctatgaaaatcgctaaagcctcggggagtctc
ttgtcgtatgacccgaatttgagattgccgttgtggccgtcagaggaagctgcaaggaaa
gagatcatgagtatctggaatttggcagatgttataaagataagtgaggaggagattaca
ttcctgactggtggagatgatccttatgatgatgaagttgtgttgcgaaagctctttcat
ccaaatcttaagcttcttgttgtttcagaaggacctaatggctgtagatactacactcag
gagtttaaaggtagagttggtggagtgaaagtgaaagcggttgatacaaccggggcagga
gatgcattcgtgagcggtctattgaacagcttagcttctgatctcactcttctcactgat
gagaagaagctaagagaggcgcttctattcgcaaacgcttgtggagctattactgctaca
gagagaggagccattccagctatgcccaccatggatgcagttcaagaccttctctcttct
tctcgctcctaa

KEGG   Brassica napus (rape): 106348199Help
Entry
106348199         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-6, chloroplastic
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106348199
   00500 Starch and sucrose metabolism
    106348199
   00520 Amino sugar and nucleotide sugar metabolism
    106348199
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106348199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106348199
NCBI-ProteinID: XP_013643336
UniProt: A0A078IVS9
AA seq 388 aa AA seqDB search
MALQATTTTFSFSAPTFRSTPPHALTSKRRISIKASSSGLSSPPLLSLSRSNLKGRAFAS
DGSTQESPSVVCFGEMLIDFVPTTSGLSLAQAPAFKKAPGGAPANVAVGIARLGGSSAFI
GKVGEDEFGYMLANILKENNVNNEGMRFDPGARTALAFVTLTNEGEREFMFYRNPSADML
LEESELDLDLIKKAKIFHYGSISLITEPCKSAHIAAAKAAKEAGVILSYDPNLRLPLWPS
ADNARDEILSVWDTADIIKISEEEIEFLTKGEDPYDDSVVRKLFHPKLKLLLVTEGPEGC
RYYTKDFSGRVHGLKVEVVDTTGAGDAFVAGILSQLACDLSLLQDEERLREALMFANACG
ALTVKERGAIPALPTKEAVLDALLKAVV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggctctccaagccactactactacgttctccttctccgctcctactttccgatcaact
cctcctcatgcattgacctcaaagcgtcgtatctccatcaaagcttcttcttcaggactc
tcttctcctcccctcctctccctttcacgatctaatctcaaaggaagagcctttgctagt
gatggctcaacgcaagagtctccctccgtggtctgtttcggagaaatgcttatcgacttc
gtaccaacaacaagtgggctttccttggcccaagcaccagctttcaaaaaggctccaggt
ggcgcccctgctaatgttgctgttggtatcgctcgtctcggtggctcttcagctttcatt
ggcaaggtcggtgaagatgagtttggttatatgcttgcaaacatcctcaaggagaacaac
gtgaacaatgaaggcatgcgttttgatcctggagccagaactgcattagctttcgtcact
ctgacaaatgaaggcgaacgtgagttcatgttctatcgtaaccccagcgccgacatgctg
ttagaagaatctgagcttgatttggatttgattaaaaaggcgaagatattccattacggt
tcgataagtctaatcacagagccgtgcaagtcagctcacatagctgcggcaaaggcagct
aaggaagctggtgtgattctttcgtatgaccctaacctcaggctccccttgtggccttct
gctgacaacgctagagatgaaatcctcagcgtttgggatactgctgatatcattaagatc
agcgaagaggagattgagtttctaacgaaaggagaagatccttatgatgattctgtcgtc
aggaagctgttccatcctaagctgaaactactccttgtcactgaaggccctgaaggttgt
cggtactacacaaaggattttagcgggagagtgcatggattgaaggtggaagtagtggac
acgacaggtgctggagatgcgtttgttgccggaatactatctcagctagcatgtgatctc
tcattgcttcaggacgaagaaagactgagagaggctctaatgtttgcgaatgcgtgtggt
gccttaaccgtaaaggagagaggtgcaataccggcacttcctacgaaagaagctgtactt
gacgccctactcaaagccgtcgtctaa

KEGG   Brassica napus (rape): 106353877Help
Entry
106353877         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-6, chloroplastic
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106353877
   00500 Starch and sucrose metabolism
    106353877
   00520 Amino sugar and nucleotide sugar metabolism
    106353877
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106353877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106353877
NCBI-ProteinID: XP_013649151
AA seq 391 aa AA seqDB search
MALQATTTTFSFSAPTFRSTPPHALTSKRRLSIKASSSSSPGLSSPPLLSLSRSNLKGRA
FASDGSTQESPSVVCFGEMLIDFVPTTSGLSLAQAPAFKKAPGGAPANVAVGIARLGGSS
AFIGKVGEDEFGYMLANILKDNNVNNEGMRFDPGARTALAFVTLTNEGEREFMFYRNPSA
DMLLEESELDLDLIKKAKIFHYGSISLITEPCKSAHIAAAKAAKEAGVILSYDPNLRLPL
WPSADNARDEILSVWDTADIIKISEEEIEFLTKGEDPYDDSVVRKLFHPKLKLLLVTEGP
EGCRYYTKDFSGRVHGLKVEVVDTTGAGDAFVAGILSQLACDLSLLQDEERLREALMFAN
ACGALTVKERGAIPALPTKEAVLEALLKAVV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctctccaagccactactacgacgttctccttctccgctcctactttccgatcaact
cctcctcacgcattaacctcaaagcgtcgtctctccatcaaagcttcttcttcttcttct
ccaggactctcttctcctcccctcctctctctttcacgatctaatctcaaaggaagagcc
tttgctagtgatggctcaacgcaagagtctccctctgtggtctgtttcggagaaatgctt
atcgacttcgtaccaaccacaagtgggctttctctggcccaagcaccagctttcaaaaag
gctccaggtggcgcccctgctaatgtcgccgttggtatcgctcgtctcggtggctcttca
gctttcattggcaaggtaggtgaagatgagtttggttacatgcttgcaaacatcctcaag
gacaacaacgtgaacaatgaaggcatgcgtttcgatcctggagccagaactgctctagct
ttcgtcactctgacaaatgaaggcgaacgtgagttcatgttctatcgaaacccaagcgcc
gacatgttgttagaagagtctgagcttgatttggatttgattaaaaaggcgaagatattc
cattacggttcgataagtctgatcacggaaccgtgcaagtcagctcacatagctgcagcg
aaggctgctaaggaagctggtgtgattctttcgtatgatcctaaccttaggctccccttg
tggccttctgcagacaacgcaagggatgaaatcctcagcgtttgggatactgctgatatt
attaagattagcgaagaggagattgagtttctaacgaaaggagaagatccgtatgatgat
tctgtcgtcaggaagttgttccatcctaagctgaaactactccttgttactgaaggtcct
gaaggttgtcggtactacactaaggattttagcgggagagtgcatggattgaaggtggaa
gtagtggacacgacaggtgctggagatgcgtttgttgctggaatactatctcaactagca
tgtgatctctctttgcttcaggacgaagaaagactgagagaggctctaatgtttgcgaat
gcgtgcggtgccttaacggtgaaggagagaggtgcaataccggcacttcctactaaagaa
gctgtgcttgaggccctactcaaagccgtcgtctaa

KEGG   Brassica napus (rape): 106353879Help
Entry
106353879         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-6, chloroplastic
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106353879
   00500 Starch and sucrose metabolism
    106353879
   00520 Amino sugar and nucleotide sugar metabolism
    106353879
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106353879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106353879
NCBI-ProteinID: XP_013649153
AA seq 391 aa AA seqDB search
MALQATTTTFSFSAPTFRSTPPHALTSKRRLSIKASSSSSPGLSSPPLLSLSRSNLKGRA
FASDGSTQESPSVVCFGEMLIDFVPTTSGLSLAQAPAFKKAPGGAPANVAVGIARLGGSS
AFIGKVGEDEFGYMLANILKDNNVNNEGMRFDPGARTALAFVTLTNEGEREFMFYRNPSA
DMLLEESELDLDLIKKAKIFHYGSISLITEPCKSAHIAAAKAAKEAGVILSYDPNLRLPL
WPSADNARDEILSVWDTADIIKISEEEIEFLTKGEDPYDDSVVRKLFHPKLKLLLVTEGP
EGCRYYTKDFSGRVHGLKVEVVDTTGAGDAFVAGILSQLACDLSLLQDEERLREALMFAN
ACGALTVKERGAIPALPTKEAVLEALLKAVV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctctccaagccactactacgacgttctccttctccgctcctactttccgatcaact
cctcctcacgcattaacctcaaagcgtcgtctctccatcaaagcttcttcttcttcttct
ccaggactctcttctcctcccctcctctctctttcacgatctaatctcaaaggaagagcc
tttgctagtgatggctcaacgcaagagtctccctctgtggtctgtttcggagaaatgctt
atcgacttcgtaccaaccacaagtgggctttctctggcccaagcaccagctttcaaaaag
gctccaggtggcgcccctgctaatgtcgccgttggtatcgctcgtctcggtggctcttca
gctttcattggcaaggtaggtgaagatgagtttggttacatgcttgcaaacatcctcaag
gacaacaacgtgaacaatgaaggcatgcgtttcgatcctggagccagaactgctctagct
ttcgtcactctgacaaatgaaggcgaacgtgagttcatgttctatcgaaacccaagcgcc
gacatgttgttagaagagtctgagcttgatttggatttgattaaaaaggcgaagatattc
cattacggttcgataagtctgatcacggaaccgtgcaagtcagctcacatagctgcagcg
aaggctgctaaggaagctggtgtgattctttcgtatgatcctaaccttaggctccccttg
tggccttctgcagacaacgcaagggatgaaatcctcagcgtttgggatactgctgatatt
attaagattagcgaagaggagattgagtttctaacgaaaggagaagatccgtatgatgat
tctgtcgtcaggaagttgttccatcctaagctgaaactactccttgttactgaaggtcct
gaaggttgtcggtactacactaaggattttagcgggagagtgcatggattgaaggtggaa
gtagtggacacgacaggtgctggagatgcgtttgttgctggaatactatctcaactagca
tgtgatctctctttgcttcaggacgaagaaagactgagagaggctctaatgtttgcgaat
gcgtgcggtgccttaacggtgaaggagagaggtgcaataccggcacttcctactaaagaa
gctgtgcttgaggccctactcaaagccgtcgtctaa

KEGG   Brassica napus (rape): 106356810Help
Entry
106356810         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106356810
   00500 Starch and sucrose metabolism
    106356810
   00520 Amino sugar and nucleotide sugar metabolism
    106356810
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106356810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 106356810
NCBI-ProteinID: XP_013651992
AA seq 326 aa AA seqDB search
MAASNGEKSLIVSFGEMLIDFVPTVSGVSLAEAPGFIKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWP
SKEEAKKQILSIWDKAEVIKVSDEELMFLTGSDNVDDETVLSLWHDNLKLLLVTLGEKGC
KYYTKSFRGSVDPFHVNTVDTTGAGDSFVGALLCNIVDDRSVLEEEARLREVLRFANACG
AITTTKKGAIPALPTVSEVQTLLNGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatccaacggcgagaaaagcttgatcgtgagcttcggtgagatgctcatcgac
ttcgttcccaccgtctccggcgtctcactcgccgaggctcctggcttcatcaaggccccc
ggtggcgcacctgccaacgtcgccatcgccgtttctcgtctcggtggtcgcgctgctttt
gtcggaaagctcggtgacgacgagttcggtcacatgctcgccggaatcttgaaacaaaac
ggcgtttccgccgaaggaatcaactttgacaccggagctaggaccgcactggcgttcgtg
acgctaagatccgacggagaacgtgagttcatgttttaccggaaccctagcgccgatatg
ctcctccgtcccgatgagcttaatctcgatctcatcaaatctgctaaggtgtttcactat
ggatcaataagcctcatcgttgagccatgtagatctgctcacctgaaggctatggaagtg
gctaaagaagctggtgcgttactctcttacgacccaaacttgaggctgcctttgtggccc
tcgaaggaggaggctaagaagcagattcttagtatctgggacaaagccgaagtgatcaaa
gtcagtgatgaagagcttatgtttttgactggatctgataacgttgatgatgagacagtt
ttgtctctgtggcatgataacttgaaacttctcttggtcactttgggtgaaaagggttgt
aaatattacaccaagagtttccgtggatctgttgatcctttccatgttaacacagtggat
acaactggagctggtgattcatttgttggtgccttgctttgcaacattgttgatgaccgc
tctgttcttgaggaggaagctcgtctaagagaagtgcttaggtttgcgaatgcatgtgga
gccattacaactaccaagaaaggagctataccagctctacctacagtgtctgaggttcag
actctcctcaatggaaactga

KEGG   Brassica napus (rape): 106365697Help
Entry
106365697         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-2
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106365697
   00500 Starch and sucrose metabolism
    106365697
   00520 Amino sugar and nucleotide sugar metabolism
    106365697
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106365697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106365697
NCBI-ProteinID: XP_013660627
AA seq 347 aa AA seqDB search
MSSTREKGLIVSFGEMLIDFVPTESGVSLAESPGFLKAPGGAPANVAIAVTRLGGRSAFV
GKLGGDEFGHMLAGILRENGVDDTGVSFDKGARTALAFVTLRSDGEREFMFYRNPSADML
LRPDELNLELIRSAKVFHYGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
PEEARKQIMSVWDKAEIIKVSDVELEFLTENKTIDDESAMSLWHPNLKLLLVTLGEDGCR
YYTKKFHGAVQTFNVNAVDTTGAGDSFVGAFLSKIVDDQYVLEEEKKLRKVLRFANACGA
ITTTKKGAIPALPSDSEALSFIKDNQRRSNNPFKSKKLRFLYCSNCS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaccagagagaaaggcctcatcgtgagcttcggcgagatgctcattgacttc
gtccccaccgaatccggcgtctccctcgctgagtccccagggtttctcaaagctcccggc
ggtgctccggccaacgtcgccattgcagtcacgcgtctcggaggtcgctccgccttcgtt
ggtaagcttggtggtgatgagtttggccatatgcttgcaggaatcttgagggagaacggt
gttgatgatacgggggtcagcttcgacaagggagcgaggaccgcactcgctttcgtcacg
ttgcgttccgacggagaaagagagtttatgttctaccggaacccgagtgccgacatgctt
cttcggccagacgaacttaatctcgaactaatcagatctgccaaagtgtttcactatgga
tcaattagtttgataacggagccgtgtaggtcagctcacttgaaggcaatggaagttgcc
aaagaggcaggagctcttctttcctacgaccctaacctaagggaacctctttggccatct
cctgaagaggctaggaaacagatcatgagcgtttgggacaaggctgagatcattaaggtc
agcgacgtggagcttgagttccttacggaaaacaaaacgattgatgatgagtcagccatg
tctctatggcatcccaatttgaagctcttgcttgttaccctcggcgaagatggatgtcgt
tactacactaagaaattccatggagctgttcaaacttttaatgtgaacgccgtggatact
accggagctggagattccttcgtaggcgcgtttctaagcaagattgtcgatgatcaatat
gtactcgaggaggaaaagaaactgaggaaagtgctgaggtttgcaaacgcttgtggagcc
atcacgaccacaaagaaaggagccattccagctcttccttcagacagtgaagctctcagc
tttattaaagacaaccagagacgtagtaacaacccttttaagtccaaaaaattgcgcttc
ttatattgtagtaattgctcatga

KEGG   Brassica napus (rape): 106368336Help
Entry
106368336         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106368336
   00500 Starch and sucrose metabolism
    106368336
   00520 Amino sugar and nucleotide sugar metabolism
    106368336
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106368336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 106368336
NCBI-ProteinID: XP_013663718
AA seq 326 aa AA seqDB search
MATSNGEKSLIVSFGEMLIDFVPTVSGVSLAEAPGFIKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKESGALLSYDPNLRLPLWP
SKEDAKKQILSIWDKAEVIKVSDEELMFLTGSDNVDDETALSLWHSNLKLLLVTLGEKGC
NYYTKSFRGSVDPFHVNAVDTTGAGDSYVGALLCNIVDDRSVLEDEARLREVLRFANACG
AITTTKKGAIPALPTESEVQSLLNGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctacttccaacggcgagaaaagcttgatcgtttccttcggcgagatgctcatcgac
ttcgtccccaccgtctccggcgtttccctcgccgaggctcctggcttcattaaggccccc
ggtggcgcacctgccaacgtcgccatcgccgtttcccgtctcggcggtcgcgctgctttt
gtcggaaagctaggtgacgacgagtttggtcacatgctcgccggaatcttgaaacaaaac
ggcgtctctgccgaaggtatcaacttcgatactggagctaggacggcactcgcgttcgtg
acgttaagatccgatggtgaacgtgagttcatgttttaccggaaccctagcgccgacatg
ctactccgtcctgatgaactcaatctcgatctcatcaaatctgctaaggtgtttcactat
ggatcaataagcctcatcgttgagccatgtagatctgcacacctgaaagcaatggaggta
gctaaagaatccggtgcgttgctctcgtacgacccaaacttgaggctgcctttgtggccc
tcgaaggaggatgctaagaagcagattcttagcatttgggacaaagctgaagtgatcaaa
gtcagcgacgaagagcttatgttcttgactgggtctgataatgttgatgatgagactgct
ttgtctctgtggcattctaacttgaagcttctcttggtcactttgggtgaaaagggttgt
aactattacaccaagagcttccgtggatctgttgatcctttccatgtgaacgcggtggat
acaaccggtgctggtgattcatatgttggtgccttgctttgcaacattgttgacgaccgc
tctgttctggaggacgaagctcgtcttagagaagtgcttaggtttgcgaatgcatgtgga
gccattacgactacaaagaaaggagctattccagctcttcctacagaatccgaggttcag
agtctcctgaatggaaactaa

KEGG   Brassica napus (rape): 106370167Help
Entry
106370167         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-2
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106370167
   00500 Starch and sucrose metabolism
    106370167
   00520 Amino sugar and nucleotide sugar metabolism
    106370167
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106370167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106370167
NCBI-ProteinID: XP_013665680
AA seq 367 aa AA seqDB search
MTSKALNHVLHPYINYTNLRSLILISIVFLLRSLEHKLELVPMASNLDKGLIVSFGEMLI
DFVPTQSGVSLAESTGFLKAPGGAPANVAIAVTRLGGRAAFVGKLGDDEFGHMLAGILRE
NGVEDKGINFDKGARTALAFVTLRSDGDREFMFYRNPSADMLLRPDELNLELIRSAKVFH
YGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWSSPEEARKQIMSIWDKAEII
KVSDVELEFLTQNKTIDDESAMSLWHPNLKLLLVTLGEKGCRYYTKGFHGSVEAFDVNAV
DTTGAGDSFIGAFLSQIVDDQTVLKEEERLRKVLRFANACGAITTTKKGAIPALPSECDA
LSLLKDK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaaagctttaaaccatgtcttacacccttatataaactacactaaccttcgt
tcacttatcctcatctctattgtcttccttctcagatctctcgaacacaaactagaactt
gttccaatggcgtcaaacctagacaaaggcctcatcgtgagcttcggcgagatgctcatt
gacttcgtccccacgcaatccggcgtttccctcgctgagtccaccggattcctcaaagct
ccaggcggtgctcccgccaacgtcgccattgcagtcacgcgtctcggtggtcgagcagct
ttcgttggaaagctcggtgatgatgagttcggacatatgcttgccggaatcttgagggag
aacggtgttgaagacaaggggatcaacttcgacaagggagctagaaccgcactcgctttc
gtcacgttgcgttcagacggggacagagagtttatgttttaccgtaacccgagcgccgac
atgcttctccgaccagatgaactcaacctcgaactaatcagatcggccaaagtgtttcac
tatggatcaataagtttgataacggagccatgcaggtcggctcacttgaaggcaatggaa
gtggcaaaagaagctggagctcttctttcctacgaccctaacctaagggaacctctttgg
tcatcccctgaagaagctaggaaacagatcatgagcatctgggacaaggctgagatcatc
aaggtcagtgacgtggagcttgagtttcttacccaaaacaaaacgatcgatgatgagtca
gcgatgtctctgtggcatcccaatttgaagctcttgcttgttaccctcggtgaaaaggga
tgtcgttactacactaagggtttccatggatctgttgaggcttttgatgtgaacgcggta
gatactaccggagctggagattcattcatcggcgcgtttctaagccagattgttgatgat
cagactgtactcaaggaggaagaaaggttgagaaaagtgctgaggttcgcaaacgcttgt
ggagccatcacgacgaccaagaagggagccattccagctcttccttctgagtgtgatgct
ctctctcttcttaaagacaaatag

KEGG   Brassica napus (rape): 106380479Help
Entry
106380479         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106380479
   00500 Starch and sucrose metabolism
    106380479
   00520 Amino sugar and nucleotide sugar metabolism
    106380479
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106380479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106380479
NCBI-ProteinID: XP_013675704
UniProt: A0A078FSV1
AA seq 326 aa AA seqDB search
MAASNSEKGLIVSFGEMLIDFVPTESGVSLAEAPGFLKAPGGAPANVAIAVSRLGGRSAF
VGKLGDDEFGHMLAGILRENGVADQGINFDTGARTALAFVTLRADGDREFMFYRNPSADM
LLRPDELDLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGAILSYDPNLREPLWP
SNEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGC
RYYAKTFRGSVDPFHVNAVDTTGAGDSFVGALLNKIAEDQSILEDEERLRKVLRFANACG
AITTTKKGAIPALPTDAEVHSFLEGK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccaacagcgagaaaggactcatcgtcagcttcggcgagatgctcatcgac
ttcgtccccaccgaatccggcgtttcgctcgccgaagctcctggcttcctcaaagctccc
ggcggcgctccggcaaacgtcgccatcgccgtttcgcgactcggcgggcgatccgccttc
gtcggaaagctcggtgacgacgagttcggacacatgctcgctgggatcctgagggagaac
ggcgtcgctgatcaggggattaacttcgacacgggtgctagaacggctttggcgttcgtg
acgttgcgtgccgacggagatcgggagtttatgttttaccggaatcctagcgccgatatg
ctcctccgtcccgacgaactcgacctcgacctcatcagatccgctaaagtgtttcactat
ggatcaataagcttaatagtggagccatgtagatcagctcacttgaaggccatggaagtg
gcgaaagaagccggagccattctttcctatgacccgaacctcagggagcctctgtggcca
tcaaacgaagaagccaagacacagatcatgagtatctgggacaaggctgagatcatcaag
gtcagcgacgtcgagctagagtttctaactggaagcaacaaaatcgatgatgaaaccgca
atgtccttgtggcatcccaacttgaagctcttgcttgtcactctcggtgaaaagggatgc
cggtattacgccaagactttccgtggatcggttgaccctttccatgtgaacgccgtggat
acaaccggagctggagattcctttgttggtgctctcctaaacaagattgctgaggatcaa
tccattctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtgga
gcaatcaccacgaccaagaaaggagccattccagctcttcccaccgatgctgaagttcac
agctttcttgaagggaagtaa

KEGG   Brassica napus (rape): 106382047Help
Entry
106382047         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106382047
   00500 Starch and sucrose metabolism
    106382047
   00520 Amino sugar and nucleotide sugar metabolism
    106382047
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106382047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106382047
NCBI-ProteinID: XP_013677460
UniProt: A0A078J0R2
AA seq 325 aa AA seqDB search
MASNGDKPLIVSFGEMLIDFVPTESGVSLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELNLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHGNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSDAEVLSFLEGK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacggagacaaaccactgatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcgtctccctcgccgaagctccgggcttcctcaaagcccccggc
ggcgctccggctaacgtcgccatcgccgtctctcgtctcggcggacgatccgccttcgtc
ggaaaactcggcgacgacgagttcggtcacatgttggctgggatcctgaggaaaaacggc
gtcgctgatcaggggatcaacttcgacactggagccagaaccgccttggcgttcgtgacg
ttgaaggctgacggagatcgggagtttatgttttaccggaatcctagcgccgatatgctt
ctccgtcccgatgaactcaacctcgagctcatcagatcggctaaggtgtttcactacgga
tcaataagcttaatagtggagccatgtaggtcagctcacttgaaggccatggaagttgcg
aaagaagcaggagctcttctttcctacgacccaaacctcagggaacctctgtggccatca
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggta
agcgacgtcgagctcgagtttctcactggaagcaacaagatcgacgatgaaaccgcaatg
tccttgtggcaccccaacttgaagctcttgcttgtcactctcggtgaaaagggttgtcgg
tattacgccaagaatttccgtggatccgttgaccctttccatgggaacgcggtggataca
acaggagctggagattcctttgttggtgctctcctaaacaagattgccgatgaccactcc
atcctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtggagca
atcaccacgaccaaaaaaggagccattccagctcttccttcagatgctgaagttctcagc
tttcttgaagggaagtag

KEGG   Brassica napus (rape): 106387197Help
Entry
106387197         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1 isoform X1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106387197
   00500 Starch and sucrose metabolism
    106387197
   00520 Amino sugar and nucleotide sugar metabolism
    106387197
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106387197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106387197
NCBI-ProteinID: XP_013682468
AA seq 126 aa AA seqDB search
MLIDFVPTESRVSLAGAPGFLKAPGGAPAIVAITVSCLGGRSAFIVKLGDDEFGHMLAGI
LRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNHSADMLLRPDELNLDLIRSIS
INTSNV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgacttcgtccccaccgaatcccgcgtctccctcgccggggctccaggtttc
ctcaaagctcccggcggcgctccggctatcgtcgccatcaccgtttcttgcctcggtgga
cgatccgccttcatcgtaaaactcggcgacgacgagttcggacacatgttggctgggatc
ctgaggaaaaacggcgtcgctgatcaggggatcaacttcgataccggagccagaaccgcc
ttggcgttcgtgacgttgaaggccgacggtgatcgggaatttatgttttaccggaatcat
agcgccgatatgttgctccgtcccgatgaactcaacctcgatctcatcagatcgattagc
atcaacaccagcaatgtttaa

KEGG   Brassica napus (rape): 106387942Help
Entry
106387942         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106387942
   00500 Starch and sucrose metabolism
    106387942
   00520 Amino sugar and nucleotide sugar metabolism
    106387942
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106387942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106387942
NCBI-ProteinID: XP_013683338
AA seq 343 aa AA seqDB search
MGENAISGDLKNIAIDTGRSETLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANV
AVGVSRLGGSSAFVGKVGDDEFGRMLAEILRLNNVDSSGMRFDHEARTALTFVTLRGDGE
REFLFFRHPSADMRLLESELDKNLIQKAKIFHYGSISLIEEPCRSTQLAAMKIAKASGSL
LSYDPNLRLALWPSEEAARKEIMSIWNLADVIKISEEEITFLTGGDDPYDDEVVLQKLFH
PNLKLLVVSEGPNGCRYFTQEFKGKVGGVKVKAVDTTGAGDAFVSGLLNSLASDLTILND
EKKLREALLFANACGAITATERGAIPAMPTMNAVQDLLSSSRS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaacgccatctcaggtgatctcaagaatatagcgatcgacacaggacgttca
gagactctcgtggtctgtttcggcgaaatgctgatcgatttcgtgccaacggtgggaggt
gtatcgctggcggaagcaccagctttcaagaaagcaccaggaggtgcacctgctaatgta
gccgttggtgtctctagactcggtggctcctctgctttcgttggaaaggtaggtgatgat
gagtttggacgaatgttagctgagattctaaggctgaacaatgtggatagctccgggatg
agattcgaccacgaagcacgcaccgctctcacctttgttacgttgagaggtgacggagag
agggagtttctgttcttcagacaccctagtgccgacatgcgtctcttggagtctgagctt
gacaagaatctaatccaaaaggccaagatttttcattacggatctatcagtttgatcgag
gagccttgccggtcgactcagctcgctgctatgaaaatcgctaaagcctcagggagtctc
ttgtcgtatgacccgaatttgagattagcgttgtggccatcagaggaagctgcgaggaaa
gagatcatgagtatatggaatttagcagatgttataaagattagtgaggaggagataacg
ttcctgactggtggagatgatccttatgatgatgaagttgtgttgcaaaagctgtttcat
ccaaatcttaagcttcttgttgtttcagaaggacctaatggctgtagatacttcactcag
gagtttaaaggtaaagttggtggagtgaaagtgaaagcggttgatacaaccggtgcagga
gatgcatttgtgagcggtctattgaacagcttagcttctgatctcaccattctcaatgat
gagaagaagctaagagaggcgcttctattcgcaaacgcttgtggagctattactgcaaca
gagagaggagccattccagctatgcccaccatgaatgctgttcaagaccttctctcttct
tctcgctcctaa

KEGG   Brassica napus (rape): 106398322Help
Entry
106398322         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-7 isoform X1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106398322
   00500 Starch and sucrose metabolism
    106398322
   00520 Amino sugar and nucleotide sugar metabolism
    106398322
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106398322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106398322
NCBI-ProteinID: XP_013694355
AA seq 343 aa AA seqDB search
MGEKPISGNLKKLTIETGRSETLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANV
AVGVSRLGGSSAFVGKVGDDEFGKMLAEILKLNNVDNSGMRFDHKARTALAFVTLRADGE
REFLFFRHPSADMLLTESELDKNLIQKAKIFHYGSISLIKEPCRSTHLAAMKIAKAAGSL
LSYDPNLRLPLWPSEEAARKEIMSIWDLADVIKISEDEITFLTGGDDPYSDEVVLQKLFH
PNLKLLVVSEGPNGCRYYTKEFKGRVGGVKVKAVDTTGAGDAFVSGLLNSLASDLTLLTD
EKKLREALLFANACGAITVTERGAIPAMPTMDAVQELLKSSRS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaaacccatctcaggtaatctcaagaaactaacgatcgagacaggacgttca
gagactctcgtggtctgtttcggtgaaatgctgatcgattttgtgccaacggtgggaggt
gtttcgctcgctgaagcaccagctttcaagaaagctccaggaggtgcacctgccaatgtt
gctgttggtgtctctagactcggtggctcctctgctttcgttggaaaggttggtgatgat
gagtttggaaaaatgttagctgagattctaaagctcaacaatgtggataactctgggatg
agattcgaccacaaagcacgtactgctctcgcctttgttacgttaagagctgatggagag
agggagtttctgttcttcagacacccgagtgctgatatgcttcttaccgagtctgagctt
gacaagaacctaatccaaaaggccaagatctttcattacggatcaatcagtttgatcaag
gaaccttgccgctcgactcatcttgcagctatgaaaatcgctaaagccgcagggagtctc
ttgtcttatgaccccaacttgaggttaccattgtggccatcagaggaagctgcaaggaaa
gagatcatgagtatctgggatctagctgatgttattaagatcagtgaggacgagattaca
ttcctgactggtggagatgatccttatagtgatgaagttgtgttgcaaaagctctttcat
cccaatcttaagcttcttgttgtgtcagaaggacctaatggctgtagatactacactaag
gagtttaaaggtagagttggtggagtgaaagtgaaagcggttgatacaaccggtgcagga
gatgcattcgtgagcggtctattaaacagcttagcttctgatctcactcttctcactgat
gagaagaaactaagagaggcgcttctattcgcaaacgcttgtggagccatcacagtaaca
gagagaggagctattccagcgatgcccaccatggatgctgttcaagagcttctcaaatct
tctcgctcctga

KEGG   Brassica napus (rape): 106400121Help
Entry
106400121         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-2
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106400121
   00500 Starch and sucrose metabolism
    106400121
   00520 Amino sugar and nucleotide sugar metabolism
    106400121
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106400121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106400121
NCBI-ProteinID: XP_013695980
UniProt: A0A078FAU9
AA seq 367 aa AA seqDB search
MTSKPLNHVLHPYINYTNLRSLILISIVFLLRSLEHKLELVPMASNLDKGLIVSFGEMLI
DFVPTQSGVSLAESTGFLKAPGGAPANVAIAVTRLGGRAAFVGKLGDDEFGHMLAGILRE
NGVEDKGINFDKGARTALAFVTLRSDGDREFMFYRNPSADMLLRPDELNLELIRSAKVFH
YGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWSSPEEARTQIMSIWDKAEII
KVSDVELEFLTQNKTIDDESAMSLWHPNLKLLLVTLGEKGCRYYTKGFHGSVEAFDVNAV
DTTGAGDSFIGAFLSQIVDDQTVLEEEERLRKVLRFANACGAITTTKKGAIPALPSEYDA
LSLLKDK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaaacctttaaaccatgtcttacacccttatataaactacactaaccttcgt
tcacttatcctcatctctattgtcttccttctcagatctctcgaacacaaactagaactc
gttccaatggcgtcaaacctagacaaaggcctcatcgtgagcttcggcgagatgctcatt
gacttcgtccccacgcaatccggcgtttccctcgctgagtccaccggattcctcaaagct
ccaggcggtgctcccgccaacgtcgccattgcagtcacgcgtctcggtggtcgagcagct
ttcgttggaaagctcggtgatgatgagttcggacatatgcttgccggaatcttgagggag
aacggtgttgaagacaaggggatcaacttcgacaagggagctagaaccgcactcgctttc
gtcacgttgcgttcagacggggacagagagtttatgttttaccgtaacccgagcgccgac
atgcttctccgaccagatgaactcaacctcgaactaatcagatcggccaaagtgtttcac
tatggatcaataagtttgataacggagccatgcaggtcggctcacttgaaagcaatggaa
gtggcgaaagaagctggagctcttctttcctacgaccctaacctaagggaacctctttgg
tcatcccctgaagaagctaggacacagatcatgagcatctgggacaaggctgagatcatc
aaggtcagcgacgtcgagctagagttccttacccaaaacaaaacgatcgatgatgagtca
gcgatgtctctgtggcatccgaatctgaagctcttgcttgttaccctcggtgaaaagggg
tgtcgttactacactaagggtttccatggatctgttgaagcatttgatgtgaacgcggtg
gatactactggagctggagattcattcatcggcgcgtttctcagccagattgttgatgat
cagactgtactcgaggaggaagagaggttgagaaaagtgctgaggttcgcaaacgcttgt
ggagccatcacgacgaccaagaagggagccattccagctcttccttcagagtatgatgct
ctctctcttcttaaagacaaatag

KEGG   Brassica napus (rape): 106400150Help
Entry
106400150         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-2
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106400150
   00500 Starch and sucrose metabolism
    106400150
   00520 Amino sugar and nucleotide sugar metabolism
    106400150
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106400150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106400150
NCBI-ProteinID: XP_013696003
AA seq 367 aa AA seqDB search
MTSKALNHVLHPYINYTNLRSLILISIVFLLRSLEHKLELVPMASNLDKGLIVSFGEMLI
DFVPTQSGVSLAESPGFLKAPGGAPANVAIAVTRLGGRAAFVGKLGDDEFGHMLAGILRE
NGVEDKGINFDKGARTALAFVTLRSDGDREFMFYRNPSADMLLRPDELNLELIRSAKVFH
YGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWSSPEEARTQIMSIWDKAEII
KVSDVELEFLTQNKTIDDESAMSLWHPNLKLLLVTLGEKGCRYYTKGFHGSVEAFDVNAV
DTTGAGDSFIGAFLSQIVDDQTVLKEEERLRKVLRFANACGAITTTKKGAIPALPSECDA
LSLLKDK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaaagctttaaaccatgtcttacacccttatataaactacactaaccttcgt
tcacttatcctcatctctattgtcttccttctcagatctctcgaacacaaactagaactt
gttccaatggcgtcaaacctagacaaaggcctcatcgtgagcttcggcgagatgctcatt
gacttcgtccccacgcaatccggcgtttccctcgctgaatcccccggattcctcaaagct
cccggaggtgctccggccaacgtcgccatcgcagtcacgcgtctcggtggtcgcgcagct
ttcgttggaaagctcggtgatgatgagttcggccacatgcttgctggtatcttgagggag
aacggtgttgaagacaaggggattaacttcgacaagggagccagaaccgcactagcattc
gtcacgttgcgttcagatggggacagagagtttatgttttaccgtaacccgagcgccgac
atgcttctccgaccagatgaactcaacctcgaactaatcagatcggccaaagtgtttcac
tatggatcaataagtttgataacggagccatgcaggtcggctcacttgaaagcaatggaa
gtggcgaaagaagctggagctcttctttcctacgaccctaacctaagggaacctctttgg
tcatcccctgaagaagctaggacacagatcatgagcatctgggacaaggctgagatcatc
aaggtcagcgacgtcgagctagagttccttacccaaaacaaaacgatcgatgatgagtca
gcgatgtctctgtggcatccgaatctgaagctcttgcttgttaccctcggtgaaaagggg
tgtcgttactacactaagggtttccatggatctgttgaagcatttgatgtgaacgcggtg
gatactactggagctggagattcattcatcggcgcgtttctcagccagattgttgatgat
cagactgtactcaaggaggaagaaaggttgagaaaagtgctgaggttcgcaaacgcttgt
ggagccatcacgacgaccaagaagggagccattccagctcttccttctgagtgtgatgct
ctctctcttcttaaagacaaatag

KEGG   Brassica napus (rape): 106404813Help
Entry
106404813         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106404813
   00500 Starch and sucrose metabolism
    106404813
   00520 Amino sugar and nucleotide sugar metabolism
    106404813
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106404813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 106404813
NCBI-ProteinID: XP_013700934
AA seq 326 aa AA seqDB search
MAASNGEKSLIVSFGEMLIDFVPTVSGVSLAEAPGFIKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWP
SKEEAKKQILSIWDKAEVIKVSDDELMFLTGSDNVDDETALSLWHDNLKLLLVTLGEKGC
KYYTKSFHGSVDPFHVNTVDTTGAGDSFVGALLSNIVDDSTILEEEARLREVLRFANACG
AITTTKKGAIPALPTVSEVQTLLIGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatccaacggcgagaaaagcttgatcgtgagcttcggtgagatgctcatcgac
ttcgttcccaccgtctccggcgtctcactcgccgaggctcctggcttcatcaaggccccc
ggtggcgcacctgccaacgtcgctatcgccgtttctcgtctcggtggtcgcgctgctttt
gttggaaagctcggtgacgacgagttcggtcacatgctcgccggaatcttgaaacaaaac
ggtgtatctgccgagggaatcaactttgacaccggagctaggacggcactcgcgttcgtg
acgctaagatccgacggagaacgtgagttcatgttttaccggaaccctagcgccgatatg
ctcctccgtcccgatgagcttaatctcgatctcatcaaatctgctaaggtgtttcactat
ggatcaataagcctcatcgttgagccatgtagatcagctcacctgaaggccatggaggtg
gctaaagaagctggtgcgttgctctcttacgacccaaacttgaggctgcctttgtggccc
tcgaaggaggaggctaagaagcagattcttagcatctgggacaaagctgaagtgatcaaa
gtcagtgatgatgagcttatgtttttgactggatctgataacgttgatgatgagacagct
ttgtctctgtggcatgataacttgaaacttctcttggtcactttgggtgaaaagggttgt
aaatattacaccaagagcttccatggatctgttgatcctttccatgttaacacagtggat
acaactggtgctggtgattcatttgttggtgccttgcttagcaacattgttgatgacagc
actattctcgaggaggaagctcgtctaagagaagtgcttaggtttgctaatgcatgtgga
gccattacaactaccaagaaaggagctataccagctctacctacagtgtctgaggttcag
actctcctcattggaaactga

KEGG   Brassica napus (rape): 106423414Help
Entry
106423414         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106423414
   00500 Starch and sucrose metabolism
    106423414
   00520 Amino sugar and nucleotide sugar metabolism
    106423414
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106423414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106423414
NCBI-ProteinID: XP_022566298
AA seq 177 aa AA seqDB search
MKKPKKEEQPLNLGLLELVRIPNVSVWYWTAPTDFVSFGEMLIDFVPTESGVSLAEAPVF
LKAPGGAPAIVAIAVSRFGGQSAFGGKLGDNEFGHMLAGILRKNGVADQEFNFDTGARTA
LAFVTLKADGDREFVFYWNHSADMLLRPDELNLELIRSVRKSLLSLSLMIFKRSRWK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcccaaaaaagaagaacagccgcttaacttgggccttttagagctggtaaga
atccctaacgtgtcagtttggtattggacagcccccaccgacttcgtcagcttcggcgag
atgctcatcgacttcgtccccaccgagtccggcgtctccctcgccgaggctccagttttc
ctcaaagctcccggcggcgctccggctatcgtcgccatcgccgtttctcgcttcggtgga
caatccgccttcggcggaaaactcggcgacaacgagttcggccacatgttggctgggatc
ctgaggaaaaacggcgtcgctgatcaggagtttaacttcgataccggagccagaaccgcc
ttggcgttcgtgacgttgaaggccgacggtgatcgggaatttgtgttttactggaatcat
agcgccgatatgttgctccgtcccgatgaactcaacctcgagctcatcagatcggtacgt
aaatctcttctctctctatccctcatgatattcaagagatccagatggaagtag

KEGG   Brassica napus (rape): 106423464Help
Entry
106423464         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-5
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106423464
   00500 Starch and sucrose metabolism
    106423464
   00520 Amino sugar and nucleotide sugar metabolism
    106423464
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106423464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106423464
NCBI-ProteinID: XP_013719698
AA seq 293 aa AA seqDB search
MATPLIVSFGEMLIDFVPDTSGVSLAESTGFLKAPGGAPANVACAISKLGGKSAFIGKFG
DDEFGHMLVNILKKNGVNSEGVCFDTHARTALAFVTLKKNGEREFMFYRNPSADMLLKES
ELNKDLIKKAKIFHYGSISLISEPCRAAHMAAMKTAKDAGVLLSYDPNVRLPLWSSTEAA
IEGIKSIWNEADIIKVSDDEVTFLTRGDAEKDDVVLSLMHDKLKLLIVTDGEKGCRYYTK
KFKGRVPGYSVKTVDTTGAGDSFVGAFLVSLGKVYTPLILDHCSHAVLLTRLF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctactccactgattgtttcctttggcgaaatgcttatcgactttgtccctgacact
tctggtgtttccttggctgagtccaccggttttcttaaagcccctggtggtgctccggct
aatgttgcatgtgccatctccaagctcggtggcaaatcagctttcattggcaagtttggt
gatgatgagtttggacacatgcttgtcaacatattgaagaagaacggtgtgaacagcgaa
ggagtttgctttgacacccatgcaaggactgctttggcctttgtgacactaaagaagaac
ggcgagagagagttcatgttttacaggaacccaagtgcggatatgcttttgaaagaatct
gaactcaacaaggatctcatcaagaaagccaagattttccactacggttccattagcttg
atctctgagccatgtagagcggcgcacatggctgctatgaaaaccgccaaggacgcagga
gttctactctcttacgaccctaatgttcggttgcctctttggtcttccactgaggctgcc
atagaaggcatcaaaagcatctggaatgaggctgatattatcaaggtaagcgatgacgag
gtaacattcctcactaggggagatgcagagaaggatgatgttgttttgtctctaatgcat
gacaagctcaagctgcttattgtaactgatggagaaaaaggttgcagatactacactaag
aaattcaaagggagagtgcctggatactctgtgaaaacagttgatacaactggagctggt
gattcttttgttggtgcatttctggtctctttagggaaagtctacactccattgatttta
gatcactgttctcatgctgttcttttgacaagattattttag

KEGG   Brassica napus (rape): 106423687Help
Entry
106423687         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106423687
   00500 Starch and sucrose metabolism
    106423687
   00520 Amino sugar and nucleotide sugar metabolism
    106423687
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106423687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106423687
NCBI-ProteinID: XP_013719910
UniProt: A0A078IJ16
AA seq 343 aa AA seqDB search
MGEKAISGNLKKLTIDTGRSETLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANV
AVGVSRLGGSSAFVGKVGDDEFGKMLAEILKLNNVDNSGMRFDHKARTALAFVTLRADGE
REFLFFRHPSADMLLTESELDKNLIQKAKIFHYGSISLIKEPCRSTHLAAMKIAKAAGSL
LSYDPNLRLPLWPSEEAARKEIMSIWELADVIKISEDEITFLTGGDDPYSDEVVLQKLFH
PNLKLLVVSEGPNGCRYYTKEFKGRVGGVKVKAVDTTGAGDAFVSGLLNSLASDLTLLTD
EKKLREALLFANACGAITVTERGAIPAMPTMDAVQELLKSSGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaaagccatctcaggtaatctcaagaaactaacgatcgacacaggacgttca
gagactctcgtggtctgtttcggtgaaatgctgatcgattttgtgccaacggtgggaggg
gtttcactcgctgaagcaccagctttcaagaaagctccaggaggtgcacctgcaaatgtt
gctgttggtgtctctagactcggtggctcctctgctttcgttggaaaggttggtgatgat
gagtttggaaaaatgttagctgagattctaaagctgaacaatgtggataactctgggatg
agattcgaccacaaagcacgtactgctctcgcctttgttacgttaagagctgacggagag
agggagtttctgttcttcagacacccgagtgctgatatgcttcttacggagtctgagctt
gacaagaacctaatccaaaaggccaagatctttcattacggatcaatcagtttgatcaag
gaaccttgccgctcgactcatcttgcagctatgaaaatcgctaaagccgcagggagtctc
ttgtcttatgaccccaacttgaggttacccttgtggccatcagaggaagctgcaaggaaa
gagatcatgagcatctgggagctagctgatgttattaagatcagtgaggacgagattaca
ttcctgactggtggagatgatccttatagtgatgaagttgtgttgcaaaagctctttcat
cccaatctcaagcttcttgttgtgtcagaaggacctaatggctgtagatactacactaag
gagtttaaaggtagagttggtggagtgaaagtgaaagcggttgatacaaccggtgcagga
gatgcattcgtgagcggtctattgaacagcttagcttctgatctcactcttctcactgat
gagaagaaactaagagaggcgcttctattcgcaaacgcttgtggagccatcacagtaaca
gagagaggagctattccagcgatgcccaccatggatgctgttcaagagcttctcaaatct
tctggctcctga

KEGG   Brassica napus (rape): 106428977Help
Entry
106428977         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1 isoform X1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106428977
   00500 Starch and sucrose metabolism
    106428977
   00520 Amino sugar and nucleotide sugar metabolism
    106428977
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106428977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106428977
NCBI-ProteinID: XP_013725174
AA seq 178 aa AA seqDB search
MLIDFVPTESGVSLAEAPGFLKAPGGTPAIVAIAVSRLGGRSAFVRKLGDDEFGHMLAGI
LRKNGVADQGINFDTGARTALAFVTLKANGDREFMFYRNHSADMLLRPDELNLELIRSVM
MKIRRENLQDALIPLSEFSEAAVMKKYGVKPDAETLDIANTAARQKSVSLFFPFFLDG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgacttcgtccccaccgagtccggcgtctccctcgccgaagctccaggtttc
ctcaaagctcctggcggcactccggctatcgtcgccatcgccgtttctcgcctcggtgga
cgatccgccttcgtcagaaaactcggcgacgacgagttcggccacatgttggctgggatc
ctgaggaaaaacggcgtcgctgatcaggggatcaacttcgataccggagccagaaccgcc
ttggcgttcgtgacgttgaaggccaacggtgatcgggaatttatgttttaccggaatcat
agcgccgatatgttgctccgtcccgatgaactcaacctcgagctcatcagatcggttatg
atgaagatcagaagagagaatcttcaagatgctctgattccgttgagtgagttctcggaa
gctgcagtgatgaagaagtatggagtgaagccagatgctgaaacccttgacattgccaac
actgccgctaggcagaaatctgtaagcctcttctttcccttttttttggatggatga

KEGG   Brassica napus (rape): 106436443Help
Entry
106436443         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-5
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106436443
   00500 Starch and sucrose metabolism
    106436443
   00520 Amino sugar and nucleotide sugar metabolism
    106436443
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106436443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106436443
NCBI-ProteinID: XP_013732864
AA seq 323 aa AA seqDB search
MATPLIVSFGEMLIDFVPDTSGVSLAESTGFLKAPGGAPANVACAISKLGGKSAFIGKFG
DDEFGHMLVNILKKNGVNSEGVCFDTHARTALAFVTLKKNGEREFMFYRNPSADMLLKES
ELNKDLIKKAKIFHYGSISLISEPCRAAHMAAMKTAKDAGVLLSYDPNVRLPLWPSTEAA
IEGIKSIWNEADIIKVSDDEVTFLTRGDAEKDDVVLSLMHDKLKLLIVTDGEKGCRYYTK
KFKGRVPGYSVKTVDTTGAGDSFVGAFLVSLGKDGSILDDEGKLKEALAFANACGAVCTT
QKGAIPALPTPSDAQQLMKSKSK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctactccactgattgtttcctttggcgaaatgcttatcgactttgtccctgacact
tctggtgtttccttggctgagtccaccggttttctcaaagcccctggtggtgctccggct
aatgttgcatgtgccatctccaagctcggtggcaaatccgctttcattggcaagtttggt
gatgatgagtttggacacatgcttgtcaacatattgaagaagaacggtgtgaacagcgaa
ggagtttgctttgacacccatgcaaggactgctttggcctttgtgacactaaagaagaac
ggcgagagagagttcatgttttacaggaacccaagtgcggatatgcttttgaaagaatct
gaactcaacaaggatctcatcaagaaagccaagattttccactacggttccattagcttg
atctctgagccatgtagagcggcgcacatggctgctatgaaaaccgccaaggacgcagga
gttctactctcttacgaccctaatgttcggttgcctctttggccttccactgaggctgcc
atagaaggcatcaaaagcatctggaatgaggctgatattatcaaggtaagcgatgacgag
gtaacattcctcactaggggcgatgcagagaaggatgatgttgttttgtctctaatgcat
gacaagctcaagctgcttattgtaactgatggagaaaaaggttgcagatactacacaaag
aaattcaaagggagagtgcctggatactctgtgaaaacagttgatacaactggagctggt
gattcttttgttggtgcatttcttgtctctttgggaaaagatggctccatactcgatgat
gaaggaaagctaaaggaggctcttgcatttgcaaatgcatgtggagctgtgtgtacaact
cagaaaggagctattccagcacttccaactccatctgatgctcagcagctcatgaaatcc
aagtccaaataa

KEGG   Brassica napus (rape): 106437745Help
Entry
106437745         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106437745
   00500 Starch and sucrose metabolism
    106437745
   00520 Amino sugar and nucleotide sugar metabolism
    106437745
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106437745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106437745
NCBI-ProteinID: XP_013734157
UniProt: A0A078GF28
AA seq 325 aa AA seqDB search
MAPTGEKPLIVSFGEMLIDFVPTESGVSLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELDLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHVNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSEAEVLSFLEKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaccggcgagaaacccctcatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcgtctccctcgccgaagccccgggcttcctcaaagcccccggc
ggcgctcccgccaacgtcgccatcgccgtctcccgcctcggcggacgatccgccttcgtc
ggaaagctcggcgacgacgagttcggccacatgctggccgggatcctgaggaaaaacggc
gtcgccgatcagggcatcaacttcgataccggagctagaaccgccttggcgttcgtgacg
ttgaaggccgacggagatcgggagtttatgttttaccggaatcctagcgccgatatgctc
ctccgtcccgatgagctcgacctcgagctcatcagatccgctaaagtgtttcactatgga
tcaataagcttaatagtggagccatgtaggtcggctcacttgaaagccatggaagtggcg
aaagaagccggagctcttctttcctacgacccaaacctcagggagcctctgtggccatcg
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggtt
agcgacgttgagcttgagtttctaactggaagcaacaagatcgatgatgagaccgcaatg
tccttgtggcatcccaacttgaagcttttgcttgtcactctcggtgaaaagggttgccgg
tattacgccaagaacttccgtggatccgttgaccctttccatgtgaacgctgtggataca
accggagctggagattcctttgtaggtgccctcctaaacaagattgccgatgatcactcc
attctcgaggacgaagagagattgcgaaaggtgctaagattcgcaaacgcttgtggagca
atcaccacaacaaaaaaaggagctattccagctcttccttcagaagctgaagttctcagc
tttcttgaaaagaaatga

KEGG   Brassica napus (rape): 106445136Help
Entry
106445136         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106445136
   00500 Starch and sucrose metabolism
    106445136
   00520 Amino sugar and nucleotide sugar metabolism
    106445136
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106445136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 106445136
NCBI-ProteinID: XP_013742101
AA seq 326 aa AA seqDB search
MSTSNGEKSLIVSFGEMLIDFVPTVSGVSLSEAPGFIKAPGGAPANVAIAVARLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWP
SKEEAKKQILSIWDKAEVIKVSDEELMFLTGSDNVDDETALSLWHDNLKLLLVTLGEKGC
NYYTKSFRGSVDPFHVDAVDTTGAGDSYVGALLCNIVDDRSVLEDEARLREVLRFANACG
AITTTKKGAIPALPTVSEVQALLNGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatccaacggcgagaaaagcttgatcgtgagcttcggtgagatgctcatcgac
tttgtccccactgtctccggcgtatcactctctgaggctcctggcttcatcaaggctccc
ggtggtgcacctgccaacgttgctattgctgtcgctcgtctcggtggccgtgctgctttt
gtcggaaagctcggtgacgatgagtttggtcacatgctcgccggaatcttgaaacaaaac
ggtgtctctgcagaaggaatcaactttgatactggagctaggacggcgcttgcgttcgtg
acgcttagatctgatggagaacgtgagttcatgttttaccggaaccctagcgccgacatg
ctcctccgtcccgatgagcttaacctcgatctcatcagatctgctaaggtgtttcactat
ggatcaattagtctcatcgtggagccatgtagatctgctcatctgaaagccatggaggtg
gctaaagaagctggtgcattgctctcttatgacccaaacttgaggctacctttgtggcct
tccaaggaggaggctaagaagcagattcttagcatctgggacaaagctgaagtgatcaaa
gtcagcgatgaagagcttatgttcttgactggatctgataacgttgatgatgagactgct
ctgtctctgtggcatgataacttgaaacttctcttggtcactttgggtgaaaagggttgt
aattattacaccaagagcttccgtggatctgttgatcctttccatgtggacgctgtggac
acaactggtgctggtgattcatatgttggtgccttgctttgcaacattgttgatgaccgc
tctgttcttgaggatgaagctcgtcttagagaagtgctcaggtttgcaaatgcatgtgga
gccattacaactaccaagaaaggagcaattccagctcttcccacagtgtctgaagttcaa
gctctcctgaatggaaactga

KEGG   Brassica napus (rape): 106445702Help
Entry
106445702         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106445702
   00500 Starch and sucrose metabolism
    106445702
   00520 Amino sugar and nucleotide sugar metabolism
    106445702
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106445702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106445702
NCBI-ProteinID: XP_013742763
UniProt: A0A078GF28
AA seq 325 aa AA seqDB search
MAPTGEKPLIVSFGEMLIDFVPTESGVSLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELDLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHVNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSEAEVLSFLEKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaccggcgagaaaccactcatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcgtctccctcgccgaagccccgggcttcctcaaagcccccggc
ggcgctcccgccaacgtcgccatcgccgtctcccgcctcggcggacgatccgcgttcgtc
ggaaagctcggcgacgacgagttcggccacatgctggccgggatcctgaggaaaaacggc
gtcgccgatcagggcatcaacttcgatacgggagcaaggaccgccttggcgttcgtgacg
ttgaaggccgacggagatcgggagtttatgttttaccggaatcccagcgccgatatgctt
ctccgtcccgatgagctcgacctcgagctcatcagatccgctaaagtgtttcactatgga
tcaataagcttaatagtggagccatgtaggtcggctcacttgaaagccatggaagtggcg
aaagaagccggagctcttctttcctacgacccaaacctcagggagcctctgtggccatcg
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggtt
agcgacgttgagcttgagtttctaactggaagcaacaagatcgatgatgagaccgcaatg
tccttgtggcatcccaacttgaagctcttgcttgtcactctcggtgaaaagggttgccgg
tattacgccaagaacttccgtggatccgttgaccctttccatgtgaacgctgtggataca
accggagctggagattcctttgttggtgccctcctaaacaagattgcagatgatcactcc
attctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtggagca
atcaccacaaccaagaaaggagctattccagctcttccttcagaagctgaagttctcagc
tttcttgaaaagaaatga

KEGG   Brassica napus (rape): 106447011Help
Entry
106447011         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106447011
   00500 Starch and sucrose metabolism
    106447011
   00520 Amino sugar and nucleotide sugar metabolism
    106447011
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106447011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106447011
NCBI-ProteinID: XP_013744310
AA seq 326 aa AA seqDB search
MAASNSEKGLIVSFGEMLIDFVPTESGVSLAEAPGFLKAPGGAPANVAIAVSRLGGRSAF
VGKLGDDEFGHMLAGILRENGVADQGINFDTGARTALAFVTLRADGDREFMFYRNPSADM
LLRPDELDLDLIRSAKVFHYGSISLIVEPCRSARLKAMEVAKEAGAILSYDPNLREPLWP
SNEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGC
RYYAKTFRGSVDPFHVNAVDTTGAGDSFVGALLNKIAEDQSILEDEERLRKVLRFANACG
AITTTKKGAIPALPTDAEVLSFLEGK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccaacagcgagaaaggactcatcgtcagcttcggcgagatgctcatcgac
ttcgtccccaccgaatccggcgtctcgctcgccgaagctccaggcttcctcaaagccccc
ggcggcgcccccgccaacgtcgccatcgccgtttcgcgtctcggcgggcgatccgccttc
gtcgggaagctcggcgacgacgagttcggacacatgctcgctgggatcctgagggagaac
ggcgtcgctgatcaggggattaacttcgacactggagctagaacggccttagcgttcgtg
acgttgcgtgccgacggagatcgggagtttatgttttaccggaaccccagcgccgacatg
ctcctccgtcccgatgaactcgacctcgacctcatcagatccgctaaagtgtttcactac
ggatcaataagcttaatagtggagccatgtaggtcagctcgcttgaaggccatggaagtg
gcgaaagaagccggagccattctttcctatgacccaaacctcagggagcctctgtggcca
tcaaacgaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaag
gtcagcgacgtcgagctcgagtttctgactggaagcaacaagatcgatgatgaaaccgca
atgtccttgtggcatcccaacttgaagcttttgcttgtcactcttggtgaaaagggatgc
cggtattacgccaagacattccgtggatccgttgaccctttccatgtgaacgccgtggat
acaaccggagctggtgattcctttgttggtgctctcctaaacaagattgccgaggatcaa
tccattctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtgga
gcaatcaccacgaccaagaaaggagctattccagctcttcccaccgatgctgaagttctc
agctttcttgaagggaagtaa

KEGG   Brassica napus (rape): 106451389Help
Entry
106451389         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106451389
   00500 Starch and sucrose metabolism
    106451389
   00520 Amino sugar and nucleotide sugar metabolism
    106451389
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106451389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106451389
NCBI-ProteinID: XP_013748772
AA seq 325 aa AA seqDB search
MASNGEKPLIVSFGEMLIDFVPTESGISLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELNLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHVNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSDAEVLSFLEGK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacggcgagaaaccactgatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcatctcgctcgctgaagcaccaggcttcctcaaagctcccggc
ggcgctccggctaacgtcgccatcgccgtctctcgtctcggcggacgatccgccttcgtc
ggaaaactcggcgacgacgagttcggtcacatgttggctgggatcctgaggaaaaacggc
gtcgctgatcaggggatcaacttcgataccggagctagaaccgccttggcgttcgtgacg
ttgaaggccgacggagatcgggagttcatgttttaccggaatcctagcgccgacatgttg
ctccgtcccgatgaactcaacctcgagctcatcagatcggctaaagtgtttcactacgga
tcaattagcttaatagtggagccatgtaggtcggctcacttgaaggccatggaagttgcg
aaagaagcaggagctcttctttcctacgacccaaacctcagggaacctctgtggccatca
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggtg
agcgacgtcgagctcgagtttctcactggaagtaacaagatcgacgatgaaaccgcaatg
tccttgtggcaccccaacttgaagctcttgcttgtcactctcggtgaaaagggttgtcgg
tattacgccaagaatttccgtggatccgttgaccctttccatgtgaacgcggtggatact
accggagctggagattcctttgttggtgctctcctaaacaagattgccgatgaccactcc
atcctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtggagca
ataaccacgaccaaaaaaggagccattccagctcttccttcagatgctgaagttctcagc
tttcttgaaggcaagtag

KEGG   Brassica napus (rape): 106451390Help
Entry
106451390         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106451390
   00500 Starch and sucrose metabolism
    106451390
   00520 Amino sugar and nucleotide sugar metabolism
    106451390
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106451390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106451390
NCBI-ProteinID: XP_013748773
AA seq 325 aa AA seqDB search
MASNGEKPLIVSFGEMLIDFVPTESGISLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELNLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHVNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSDAEVLSFLEGK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacggcgagaaaccactgatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcatctcgctcgctgaagcaccaggcttcctcaaagctcccggc
ggcgctccggctaacgtcgccatcgccgtctctcgtctcggcggacgatccgccttcgtc
ggaaaactcggcgacgacgagttcggtcacatgttggctgggatcctgaggaaaaacggc
gtcgctgatcaggggatcaacttcgataccggagctagaaccgccttggcgttcgtgacg
ttgaaggccgacggagatcgggagttcatgttttaccggaatcctagcgccgacatgttg
ctccgtcccgatgaactcaacctcgagctcatcagatcggctaaagtgtttcactacgga
tcaattagcttaatagtggagccatgtaggtcggctcacttgaaggccatggaagttgcg
aaagaagcaggagctcttctttcctacgacccaaacctcagggaacctctgtggccatca
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggtg
agcgacgtcgagctcgagtttctcactggaagtaacaagatcgacgatgaaaccgcaatg
tccttgtggcaccccaacttgaagctcttgcttgtcactctcggtgaaaagggttgtcgg
tattacgccaagaatttccgtggatccgttgaccctttccatgtgaacgcggtggatact
accggagctggagattcctttgttggtgctctcctaaacaagattgccgatgaccactcc
atcctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtggagca
ataaccacgaccaaaaaaggagccattccagctcttccttcagatgctgaagttctcagc
tttcttgaaggcaagtag

KEGG   Brassica napus (rape): 106451392Help
Entry
106451392         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106451392
   00500 Starch and sucrose metabolism
    106451392
   00520 Amino sugar and nucleotide sugar metabolism
    106451392
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     106451392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 106451392
NCBI-ProteinID: XP_013748775
AA seq 325 aa AA seqDB search
MASNGEKPLIVSFGEMLIDFVPTESGISLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFV
GKLGDDEFGHMLAGILRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNPSADML
LRPDELNLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLREPLWPS
KEEAKTQIMSIWDKAEIIKVSDVELEFLTGSNKIDDETAMSLWHPNLKLLLVTLGEKGCR
YYAKNFRGSVDPFHVNAVDTTGAGDSFVGALLNKIADDHSILEDEERLRKVLRFANACGA
ITTTKKGAIPALPSDAEVLSFLEGK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacggcgagaaaccactgatcgtcagcttcggcgagatgctcatcgacttc
gtccccaccgagtccggcatctcgctcgctgaagcaccaggcttcctcaaagctcccggc
ggcgctccggctaacgtcgccatcgccgtctctcgtctcggcggacgatccgccttcgtc
ggaaaactcggcgacgacgagttcggtcacatgttggctgggatcctgaggaaaaacggc
gtcgctgatcaggggatcaacttcgataccggagctagaaccgccttggcgttcgtgacg
ttgaaggccgacggagatcgggagttcatgttttaccggaatcctagcgccgacatgttg
ctccgtcccgatgaactcaacctcgagctcatcagatcggctaaagtgtttcactacgga
tcaattagcttaatagtggagccatgtaggtcggctcacttgaaggccatggaagttgcg
aaagaagcaggagctcttctttcctacgacccaaacctcagggaacctctgtggccatca
aaggaagaagccaagacacagatcatgagcatctgggacaaggctgagatcatcaaggtg
agcgacgtcgagctcgagtttctcactggaagtaacaagatcgacgatgaaaccgcaatg
tccttgtggcaccccaacttgaagctcttgcttgtcactctcggtgaaaagggttgtcgg
tattacgccaagaatttccgtggatccgttgaccctttccatgtgaacgcggtggatact
accggagctggagattcctttgttggtgctctcctaaacaagattgccgatgaccactcc
atcctcgaggacgaagagagattgagaaaggtgctaagattcgcaaacgcttgtggagca
ataaccacgaccaaaaaaggagccattccagctcttccttcagatgctgaagttctcagc
tttcttgaaggcaagtag

KEGG   Brassica napus (rape): 111200353Help
Entry
111200353         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4 isoform X1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111200353
   00500 Starch and sucrose metabolism
    111200353
   00520 Amino sugar and nucleotide sugar metabolism
    111200353
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     111200353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 111200353
NCBI-ProteinID: XP_022546929
AA seq 326 aa AA seqDB search
MATSNGEKSLIVSFGEMLIDFVPTVSGVSLAEAPGFIKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWP
SKEEAKKQILSIWDKAEVIKVSDEELMFLTGSDNVDDETALSLWHDNLKLLLVTLGEKGC
NYYTKSFRGSVDPFHVNAVDTTGAGDSYVGALLCNFVDDRSVLEDEARLREVLRFANACG
AITTTKKGAIPALPTESEVQSLLNGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctacttccaacggcgagaaaagcttgatcgtttccttcggcgagatgctcatcgac
ttcgtccccaccgtctccggcgtttccctcgccgaggctcctggcttcattaaggccccc
ggtggcgcacctgccaacgtcgccatcgccgtttcccgtctcggcggtcgcgctgctttt
gtcggaaagctaggtgacgacgagtttggccacatgctcgccggaatcttgaaacaaaac
ggcgtctctgccgaaggtatcaacttcgatactggagctaggacggcgcttgcgttcgtg
acgttaagatccgatggtgaacgtgagttcatgttttaccggaaccctagcgccgacatg
ctcctccgtcctgatgaactcaatctcgatctcatcaaatctgctaaggtgttccactat
ggatcgataagcctcattgttgagccatgtagatctgcgcacctgaaagccatggaggtg
gctaaagaagctggtgcgttgctctcgtacgacccaaacctgaggctgccattgtggccc
tcgaaggaggaggctaagaaacagatccttagcatctgggacaaagctgaagtgatcaaa
gtcagcgacgaagagcttatgttcttgactgggtctgataatgttgatgatgagactgct
ttgtctctgtggcatgataacttgaaacttctcttggtcactttgggtgaaaagggttgt
aactattacaccaagagtttccgtggatctgttgatcctttccatgtgaacgcagtggat
acaactggtgccggtgattcatatgttggtgccttgctttgcaactttgttgatgaccgc
tctgttctcgaggacgaagctcgacttagagaagtgcttaggtttgcgaatgcatgtgga
gccattacaactaccaagaaaggagctattccagctcttcctacagagtctgaggttcag
agtctcctcaatggaaactga

KEGG   Brassica napus (rape): 111200763Help
Entry
111200763         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111200763
   00500 Starch and sucrose metabolism
    111200763
   00520 Amino sugar and nucleotide sugar metabolism
    111200763
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     111200763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 111200763
NCBI-ProteinID: XP_022547815
AA seq 143 aa AA seqDB search
MATSTGENSLIVSFGEMLIDFVPTVSGVSLAEAPGFIKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIKSVRYFYIYLT
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctacttccaccggcgagaatagcttgatcgtttccttcggcgagatgctcatcgac
ttcgttcccaccgtctccggcgtatccctcgctgaagctcctggcttcatcaaggccccc
ggtggcgcacctgccaacgtcgccatcgccgtttcccgtctcggtggccgagctgctttt
gtcggaaagctaggtgacgacgagtttggccacatgctcgccggaatcttgaaacaaaac
ggcgtctctgccgaaggtatcaacttcgatactggagctaggacggcactcgcgttcgtg
acgttaagatccgatggtgaacgtgagttcatgttttaccggaaccctagcgccgacatg
ctactccgtcctgatgaactcaatctcgatctcatcaaatctgtacgttatttttacatt
tacttaacttga

KEGG   Brassica napus (rape): 111204344Help
Entry
111204344         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1 isoform X1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111204344
   00500 Starch and sucrose metabolism
    111204344
   00520 Amino sugar and nucleotide sugar metabolism
    111204344
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     111204344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 111204344
NCBI-ProteinID: XP_022554541
AA seq 126 aa AA seqDB search
MLIDFVPTESRVSLAGAPGFLKAPGGAPAIVAITVSCLGGRSAFIVKLGDDEFGHMLAGI
LRKNGVADQGINFDTGARTALAFVTLKADGDREFMFYRNHSADMLLRPDELNLDLIRSIS
INTSNV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgacttcgtccccaccgaatcccgcgtctccctcgccggggctccaggtttc
ctcaaagctcccggcggcgctccggctatcgtcgccatcaccgtttcttgcctcggtgga
cgatccgccttcatcgtaaaactcggcgacgacgagttcggacacatgttggctgggatc
ctgaggaaaaacggcgtcgctgatcaggggatcaacttcgataccggagccagaaccgcc
ttggcgttcgtgacgttgaaggccgacggtgatcgggaatttatgttttaccggaatcat
agcgccgatatgttgctccgtcccgatgaactcaacctcgatctcatcagatcgattagc
atcaacaccagcaatgtttaa

KEGG   Brassica napus (rape): 111211413Help
Entry
111211413         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-1
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111211413
   00500 Starch and sucrose metabolism
    111211413
   00520 Amino sugar and nucleotide sugar metabolism
    111211413
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     111211413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 111211413
NCBI-ProteinID: XP_022568207
AA seq 177 aa AA seqDB search
MKKPKKEEQPLNLGLLELVRIPNVSVWYWTAPTDFVSFGEMLIDFVPTESGVSLAEAPVF
LKAPGGAPAIVAIAVSRFGGQSAFGGKLGDNEFGHMLAGILRKNGVADQEFNFDTGARTA
LAFVTLKADGDREFVFYWNHSADMLLRPDELNLELIRSVRKSLLSLSLMIFKRSRWK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcccaaaaaagaagaacagccgcttaacttgggccttttagagctggtaaga
atccctaacgtgtcagtttggtattggacagcccccaccgacttcgtcagcttcggcgag
atgctcatcgacttcgtccccaccgagtccggcgtctccctcgccgaggctccagttttc
ctcaaagctcccggcggcgctccggctatcgtcgccatcgccgtttctcgcttcggtgga
caatccgccttcggcggaaaactcggcgacaacgagttcggccacatgttggctgggatc
ctgaggaaaaacggcgtcgctgatcaggagtttaacttcgataccggagccagaaccgcc
ttggcgttcgtgacgttgaaggccgacggtgatcgggaatttgtgttttactggaatcat
agcgccgatatgttgctccgtcccgatgaactcaacctcgagctcatcagatcggtacgt
aaatctcttctctctctatccctcatgatattcaagagatccagatggaagtag

KEGG   Brassica napus (rape): 111213913Help
Entry
111213913         CDS       T04128                                 

Definition
(RefSeq) probable fructokinase-4
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111213913
   00500 Starch and sucrose metabolism
    111213913
   00520 Amino sugar and nucleotide sugar metabolism
    111213913
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     111213913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 111213913
NCBI-ProteinID: XP_022571475
AA seq 326 aa AA seqDB search
MATSDGEKSLIVSFGEMLIDFVPTVSGVSLSEAPGFIKAPGGAPANVAIAVARLGGRAAF
VGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWP
SKEEAKKQILSIWDKAEVIKVSDEELMFLTGSDNVDDETALSLWHDNLKLLLVTLGEKGC
NYYTKSFRGSVDPFHVDAVDTTGAGDSYVGALLCNIVDDRSVLEDEARLREVLRFANACG
AITTTKKGAIPALPTVSEVETLLNAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctacatccgacggcgagaaaagcttgatcgtgagcttcggtgagatgctcatcgac
tttgtccccaccgtctccggcgtatccctctccgaggctcctggcttcatcaaggctccc
ggtggtgcgcctgccaacgttgccattgctgtcgcccgtctcggtggccgtgctgctttt
gtcggaaagctcggtgacgatgagtttggtcacatgctcgccgggatcttgaaacaaaac
ggtgtctctgcagaaggaatcaactttgacaccggagctaggacggcgcttgcgttcgtg
acgcttagatctgatggagaacgtgagttcatgttttaccggaaccctagcgccgacatg
ctcctccgtcctgatgagcttaacctcgatctcatcagatctgctaaggtgtttcactat
ggatcaataagtctcatcgtcgagccatgtagatctgctcacctgaaggccatggaggtg
gctaaagaagctggtgcgttgctctcttatgacccaaacttgaggctacctttgtggcct
tccaaggaggaggctaagaagcagattcttagcatctgggacaaagctgaagtgatcaaa
gtcagcgatgaagagcttatgttcttgactggatctgataacgttgatgatgagactgcg
ttgtctctgtggcatgataacttgaaacttctcttggtcactttgggtgaaaagggttgt
aattattacaccaagagcttccgtggatctgttgatcctttccatgtggacgctgtggac
acaactggtgctggtgattcatatgttggtgccttgctttgcaacattgttgatgaccgt
tctgttcttgaggatgaagctcgtcttagagaagtgctcaggtttgctaatgcatgtgga
gccattacaacaaccaagaaaggagcaattccagctcttcccacagtgtctgaagttgaa
actctcctaaatgcaaagtga

DBGET integrated database retrieval system