KEGG   Brassica napus (rape): 106346167Help
Entry
106346167         CDS       T04128                                 

Definition
(RefSeq) transcription initiation factor TFIID subunit 15-like isoform X1
  KO
K14651  transcription initiation factor TFIID subunit 15
Organism
bna  Brassica napus (rape)
Pathway
bna03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    106346167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bna03021]
    106346167
   03019 Messenger RNA biogenesis [BR:bna03019]
    106346167
Transcription machinery [BR:bna03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     106346167
Messenger RNA biogenesis [BR:bna03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     106346167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP RRM_1 Rubredoxin
Motif
Other DBs
NCBI-GeneID: 106346167
NCBI-ProteinID: XP_013640877
AA seq 377 aa AA seqDB search
MATNGSVYVSNLPLGTDENMLAEYFGTIGLLKRDKRTGTPKVWLYRDKETDEPKGDATVT
YEDPHAALAAVEWFNNKEFHGSVIGVFMAESKRKSGGDHQSEGFGFDGGDIASKETNGGG
GGRGRGQGDSSAKPWQQDGDWMCPNTSCTNVNFAFRGVCNRCGTARPAGASGGGMGGGGR
GRGRGGGADGGPPGKGASTGLFGPNDWSCPMCGNVNWAKRLKCNVCNTNKPGQNEGGVRG
GRGGGYKELDEQELEETKRRRREAEEDDGEMYDEFGNLKKKYRVKTNQADTRPVVAAGRA
GWQVEELGVDRDGRERSRDRQRDRGDKHRDHHNYDKDRRRSRSRERERGGKERDYDYDHD
RNRDRDRDYSRGSRYRN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctacgaatggatcagtctacgtttcgaatctcccactaggaactgatgagaacatg
ttggctgagtattttggaaccattgggttactaaagagagataagcggactggtactcct
aaagtgtggctgtaccgagacaaagagactgatgagccgaagggagatgctactgttacc
tatgaggacccgcatgctgctttggctgctgttgagtggtttaataacaaagagttccat
ggtagcgttattggagtttttatggcggagtcgaagaggaaaagtggaggagatcatcag
agtgagggttttggattcgatggaggtgatattgctagtaaggagactaatggaggtggt
ggtggaagggggagaggtcagggtgattcttccgccaagccgtggcagcaagacggtgac
tggatgtgcccaaataccagttgtacaaatgtgaattttgcgttccgtggggtttgtaac
cgctgtggaactgctagaccggctggtgcatctggtggcggcatgggtggtgggggccgt
ggaaggggtcgaggtggaggtgctgatggtgggccaccggggaagggtgcttctaccggt
ctttttggtccaaatgattggtcttgtccaatgtgtgggaatgtcaactgggctaagcgt
ttaaaatgtaatgtctgcaacaccaataaacctggtcagaatgaaggtggcgtgagggga
ggtcgtggtggtggctacaaagaattggatgaacaagaattagaggaaactaagagacgt
aggcgtgaggctgaagaagatgatggtgaaatgtatgatgagtttggcaatctaaagaag
aagtaccgtgttaaaacaaaccaggctgacaccagacctgttgttgctgctggtcgtgct
gggtggcaagtcgaggaattaggtgttgatagagatggaagagagagaagcagagacagg
caaagagaccgtggagataagcatagagatcatcataattatgataaggatagacggaga
agcagaagccgagagagggaaagaggaggcaaggaacgtgactatgactatgaccatgat
cggaacagagaccgagacagagactacagtcgcggaagcaggtaccgtaattga

DBGET integrated database retrieval system