KEGG   Brassica napus (rape): 106346212Help
Entry
106346212         CDS       T04128                                 

Definition
(RefSeq) biotin carboxylase, chloroplastic
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106346212
   00640 Propanoate metabolism
    106346212
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106346212
Enzymes [BR:bna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     106346212
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106346212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 106346212
NCBI-ProteinID: XP_013640932
AA seq 536 aa AA seqDB search
MDASMITNCKSTASLPSLFLGRSGGSIRSSQCNVMMGKAITFPSQKTQTLKVSRKNVNRR
CGGGALGATCSTGDKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAV
CIGEAPSNQSYLVIPNVLSAAISRGCTMLHPGYGFLSENALFVEMCREHRINFIGPNPDS
IRVMGDKSTARETMKNTGVPTVPGSDGLLKSTEEGVKLANEIGFPVMIKATAGGGGRGMR
LANEPSEFVKLLQAAKSEAAAAFGNDGVYLEKYVQNPRHIEFQILADKFGNVVHFGERDC
SIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYVGVGTVEFLLDERGSFYFMEM
NTRIQVEHPVTEMIYSVDLIEEQIRVAMGEKLRYTQDEIVLRGHSIECRINAEDPFKGFR
PGPGRITSYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTRERAIERMKRALND
TIITGVPTTIEYHKLILEVEDFKNGKVDTAFIPKHEEELAEPHEIVLVKDLTNAAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctcaatgattactaattgcaaatccactgcctcccttccctctttgttcctg
gggaggtcgggaggtagcattagaagttcccagtgtaatgtcatgatggggaaagccatt
accttcccgagccaaaagactcagactttgaaggttagccggaagaacgtgaataggagg
tgtggtggtggtgcgcttggtgctacttgcagtactggggataagattcttgtggctaac
agaggtgaaattgctgtccgtgtgatccgaactgctcatgaaatggggattccttgtgtt
gctgtttactcaaccattgacaaggatgcattgcatgtcaaattggctgatgaggctgtt
tgtattggtgaagctcctagcaaccagtcgtatttggtgataccgaatgttctgtcagct
gcaattagccgaggatgcacaatgcttcatcctggatatggattcctttcagagaacgct
ctttttgttgagatgtgcagagagcacaggatcaactttattggaccaaatcctgatagc
atccgtgtcatgggtgacaaatcaactgccagggagacgatgaagaatactggtgtccca
actgtaccagggagtgatggactattaaagagcacagaagaaggagtcaaactcgccaat
gagattgggtttcctgtgatgatcaaggcaacagctggtggtggtggacgtggaatgcgt
ctcgctaatgaaccgtcagagtttgtgaaactgctgcaggcagcaaagagtgaggccgcg
gctgcttttggaaatgatggagtttatctggagaagtatgtgcaaaatccccggcatatt
gagttccagattcttgcagataaatttggaaatgttgtgcactttggcgagcgtgactgc
agcatccagagacgtaaccaaaagttgcttgaagaagcaccttcccctgcactgacccct
gagttgcgaaaagccatgggtgatgcagcagttgcagcagcagcgtccattgggtacgtt
ggtgttggtaccgtggagttccttttggatgagagaggttccttctatttcatggaaatg
aatactagaatccaggtggagcatcctgtgacagagatgatttactccgttgatttgatt
gaagaacagattcgtgttgctatgggagagaaactgcgttatacacaggatgagattgtg
cttagaggacactctattgaatgtcgtatcaatgcagaggacccatttaaaggattcaga
cctggacccggaagaataacatcatatctgccatctggaggtccctttgtcagaatggat
agtcatgtgtatcccgactatgttgttcctccaagctatgactctcttcttggaaagctt
attgtatgggctccaacgagggaaagggcaattgagcggatgaaacgtgcacttaatgac
actattattacaggggttcccaccaccattgagtaccacaaacttatccttgaagttgag
gatttcaagaacggaaaagttgacactgcattcatccccaagcatgaagaggaattagca
gagcctcatgaaattgtgctagtgaaagatttgacaaatgcagctgcttag

KEGG   Brassica napus (rape): 106350529Help
Entry
106350529         CDS       T04128                                 

Definition
(RefSeq) biotin carboxylase, chloroplastic-like
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106350529
   00640 Propanoate metabolism
    106350529
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106350529
Enzymes [BR:bna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     106350529
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106350529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 106350529
NCBI-ProteinID: NP_001303080
UniProt: Q93Y50
AA seq 535 aa AA seqDB search
MDASMITNCKSTASLPSLFLGRSGGSLRSSQCNVMMGKTITFPSQKTQTLKVSRKNLNRR
CGGGALGATCSGDKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAVC
IGEAPSNQSYLVIPNVLSAAISRGCTMLHPGYGFHSENALFVEMCREHRINFIGPNPDSI
RVMGDKSTARETMKNAGVPTVPGSDGLLKSTEEGVKLANEIGFPVMIKATAGGGGRGMRL
ANEPSEFVKLLQAAKSEAAAAFGNDGVYLEKYVQNPRHIEFQILADKFGNVVHFGERDCS
IQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYVGVGTVEFLLDERGSFYFMEMN
TRIQVEHPVTEMIYSVDLIEEQIRVAMGEKLRYTQDEIVLRGHSIECRINAEDPFKGFRP
GPGRITAYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTRERAIERMKRALNDT
IITGVPTTIEYHKLILEVEDFKNGKVDTAFIPKHEEELAEPHEIVLVKDLTNAAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctcaatgattactaattgcaaatccactgcctcccttccctctttgttcctg
gggagatcgggaggtagtcttagaagctcccagtgtaatgtcatgatggggaaaaccatt
accttcccgagccaaaagactcagactttgaaggttagccggaagaacttgaataggagg
tgtggtggtggtgcgcttggtgctacctgcagtggggataagattcttgtggctaacaga
ggtgaaattgctgtccgtgtgatccgaactgctcatgagatggggattccttgtgttgct
gtttactcaaccatcgacaaggatgcattgcatgtcaaattggctgacgaggctgtttgt
attggtgaagctcctagcaaccagtcgtatttggtgataccgaatgttctgtcagctgca
atcagccgaggatgcacaatgcttcatcctggatatggattccattcagagaacgctctt
tttgttgagatgtgcagagagcacaggatcaactttattggaccaaatcctgatagcatc
cgtgtcatgggtgacaaatcaactgccagggagacgatgaagaatgcaggtgtcccaact
gtaccagggagtgatggactattaaagagcacagaagaaggagtcaagctcgccaatgag
attgggttccctgtgatgatcaaggcaacagctggtggtggtggacgtggaatgcgtctt
gctaatgaaccgtcagagtttgtgaaactgctgcaggcagcaaagagtgaggccgcggct
gcttttggaaatgatggagtttatctggagaagtacgtccaaaatccccgccatattgag
ttccagattcttgcagataaatttggaaatgttgtgcacttcggcgagcgtgactgcagc
atccagagacggaaccaaaagttgctggaagaagcaccttctcctgcactgacccctgag
ttgcgaaaagccatgggtgatgcagctgttgcagcagcagcgtcgattggctacgttggt
gttggtaccgtggagttccttttggatgagagaggttccttctatttcatggagatgaac
actagaatccaggtggagcatcctgtgacagagatgatttactctgttgatttgattgaa
gaacagattcgtgttgcaatgggagagaaactgcgttatacacaggatgagattgtgcta
agaggacactctattgaatgccgtatcaatgcagaggacccattcaaaggattcagacct
ggacctggaagaataacagcatatctgccatctggaggtccttttgttagaatggatagt
catgtgtatcccgactatgttgttcctccaagctatgactctcttcttggaaagcttatt
gtatgggctccaacgagggaaagggcaattgagcggatgaaacgtgcacttaatgacact
attattacaggggttcccaccaccattgagtaccacaaacttatccttgaagttgaggat
ttcaagaacggaaaagttgacactgctttcatccccaagcatgaggaggaattagcagag
cctcatgaaattgtgctagtgaaagatttgacaaacgcagctgcttag

KEGG   Brassica napus (rape): 106354458Help
Entry
106354458         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106354458
   00640 Propanoate metabolism
    106354458
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106354458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 106354458
NCBI-ProteinID: XP_013649844
UniProt: A0A078JG76
AA seq 276 aa AA seqDB search
MASSSFSLTSPAASVYGATQASSQRPLPTTRSRLPRSVSFRLSAKPKLRFLSKPSRSSYP
VVKAQSNQVGGNASSKASAPVKIDESSAEEKDSNTSSSAELATEESISEFLTQVTTLVKL
VDSRDIVELQLKQLDCELVIRKKEALPQAQTPAPYVMMQQPNQPSYVQATAPPPPSAPAP
STPASSPPPSPPSPAKSSLPTVKSPMAGTFYRSPGPGEPPFIKVGDKVQKGQVLCIVEAM
KLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttcgttttccctcacgtccccggctgcttccgtctatggagccactcaa
gcctcgtcgcagcgacctctcccaaccacccgctctcgtctccctcgcagtgtctccttc
cgtctctccgccaagcctaagcttcgctttctctccaagcctagtcgcagtagctaccct
gtggtgaaagcccaatctaaccaggttggtggcaatgcgtcatcaaaagcttcagctcct
gtaaaaattgatgagtcatcagctgaagaaaaggattcaaacacttcttcttcagctgag
ttagctacagaggagtctatctctgagtttctgacccaagtaacaactcttgtcaagctt
gtggattctagagacattgttgagttgcagttgaaacagctcgactgtgagcttgttatt
cggaaaaaggaagctttacctcaggcccaaacccctgcgccttatgtgatgatgcagcaa
ccaaaccaaccatcttatgttcaagcaactgctcctcctccgccttctgcacctgcacct
tcaactccagcctcctcgcctccaccatccccacctagtccagcgaaatcatcgcttcca
acggttaaaagtcccatggcaggcactttttaccgtagtccaggacctggtgaaccaccc
tttatcaaggttggagacaaagtgcagaagggacaagttctatgcatcgttgaagccatg
aagctaatgaatgaaatagagtctgatcaaacgggaaccgtagtggatatcgttgcagaa
gatggcaagcctgttagtctcgacactcctctgtttgtggttcaaccgtag

KEGG   Brassica napus (rape): 106354758Help
Entry
106354758         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic-like
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106354758
   00640 Propanoate metabolism
    106354758
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106354758
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106354758
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106354758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 106354758
NCBI-ProteinID: XP_013650237
AA seq 771 aa AA seqDB search
MASMSHSSIALGGASASASDYLRSSANGVTGVSLRALGRRTMVTATTRSSNNLYVTARLK
KGKKFDHPWPANPDPNVKGGVLSYLSDFKPLGNAQKPVTLDFERPLVELEKKIVDVRKMA
EETGLDFTEQIITLETKYRQALKDLYTHLTPIQRVNIARHPNRPTFLDHIHNITDKFMEL
HGDRAGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYY
ADHHGFPIVTFIDTPGAYADLKSEEKGQGEAIANNLRTMFGLKVPILSIVIGEGGSGGAL
AIGCANKMLMLENAVFYVASPEACAAILWQTSKAAPEAAEKLRITSKELVNLNVADGIIP
EPLGGAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIEGEPVEPEK
KINMKRRDAVASTSRNLEGEVEKLREQILKAKEASPESDEGEELSSQVLKEMIEKLKSDI
DEEYTKAAKAMGLEERLAATREEFSKANAEEHLMHPVLIERIEKLKEEFNARLSEAPNYE
SLKAKLDMLKDFSRAKAASDAASVKKEINKRFQEAVERPEVREKVEAVKAEVASSGASSF
EELSDELKEKVLKTKREVEAEMAVVLKSMGLELEAVKPNLKEVVAESPNENIQEKIEKLN
REITEKIEEVVRTPEIKSMVELLKVETAKASQMPDQGSQKIEALEMQIKQKIADALSMSG
LQEKQEELEKELAAARELAGEESDESVKEDDDDDEDGSGSGRSEIINPSFA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatgtctcattcatccatagcattgggtggagcttccgcttctgcttcggat
tacttgcgtagttcggccaacggtgtcactggcgtctcattaagagcccttgggaggaga
acaatggttacagctactacaaggagtagtaacaacctctacgtgacagctcggctcaag
aaaggcaagaagttcgatcacccctggcctgctaaccctgaccccaacgtcaaaggagga
gtcttgtcttacctctccgactttaaacctttggggaacgctcaaaagcctgtcactttg
gatttcgagagaccgcttgttgaactcgagaagaagattgttgatgtgaggaagatggcg
gaagaaaccggtttggactttactgagcagattatcactttggagactaagtatagacag
gcgttgaaagatctttacacgcatcttactcctatacagcgtgtgaacattgctcgccat
cccaaccgtcctactttccttgatcatatacataacatcactgacaagtttatggagctt
catggagaccgggcgggttatgatgaccctgcaattgtgactggtattggaaccatagat
ggcaaaagatacatgttcatcggtcaccagaaaggtagaaacaccaaagaaaatataatg
cgtaactttgggatgcctactcctcatggttacaggaaggcactacggatgatgtattac
gcagaccatcacggtttccccattgtgacattcattgacactcctggagcctatgcagac
cttaaatcagaggaaaaaggacagggtgaagcgattgccaacaatctaaggacgatgttt
ggtcttaaagtgccgattctttctattgtcattggcgaaggtggttctggtggtgcctta
gccattggctgtgctaataaaatgctgatgctcgaaaacgcagttttctatgttgccagt
ccagaggcatgtgcagcgatcttgtggcagacttccaaggctgctcctgaggctgctgaa
aagcttaggattacctccaaggagctggtcaatcttaatgtagccgatggaatcatacct
gaacctcttggtggagcccatgctgatccttcatggacatcgcagcagataaagattgct
atcaatgaaaacatgaatgaatttgggaaaatgagtggggaggagctgctgaagcacagg
atggctaagtaccggaagatcggagtgttcattgagggtgaaccagtagagcctgagaag
aaaatcaacatgaagaggagggacgctgtggcttccaccagccggaacctagagggcgag
gttgagaagctgagggagcagattctgaaagccaaggaagcctctccagagtctgatgag
ggtgaggagctttcgagccaagttcttaaggagatgattgagaaacttaaatcggatatc
gacgaagagtacactaaagctgcgaaagcaatggggttagaggagagactagccgcgacg
cgcgaggagttttcgaaagccaatgcggaggagcatcttatgcacccggtgctcatcgag
agaatcgagaagcttaaagaagaattcaatgcacgtttaagcgaagctcctaactacgag
agtttaaaagctaagctggacatgttgaaggacttctccagagccaaggcggcctcagac
gccgcttcggttaagaaggagattaataaacggtttcaggaagctgtggagcgtcctgag
gttagagagaaggttgaagcggttaaagccgaggttgctagctcgggtgcgtcttctttc
gaagagttgagcgatgagctgaaagagaaagttttgaagacgaagagggaggttgaagca
gagatggctgttgtgttgaagtcgatgggtctggagctggaggctgtgaaaccgaatctg
aaggaagtagtagccgagtctcctaacgaaaacattcaagaaaagattgagaagctgaac
cgagagatcacggagaagattgaggaggtggtgaggacgccggagatcaagagcatggtt
gagttgctgaaagtggagactgcaaaggcgagccagatgcctgatcaggggagtcagaag
atcgaggcgcttgagatgcagatcaagcagaagatcgctgatgctttgagcatgtctgga
ctgcaggagaaacaagaggagcttgagaaggagcttgcagctgcgcgtgagctagctgga
gaggaatcagatgagagtgtgaaggaagatgatgatgacgatgaagatggttcaggatcg
ggaagatccgagataattaaccctagcttcgcctga

KEGG   Brassica napus (rape): 106354759Help
Entry
106354759         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106354759
   00640 Propanoate metabolism
    106354759
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106354759
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106354759
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106354759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 106354759
NCBI-ProteinID: XP_013650239
AA seq 770 aa AA seqDB search
MASMSHSSIALGGASASASDYLRSSANGVTGVSLRALGRRTMVTATTRSSNLYVTARLKK
GKKFDHPWPANPDPNVKGGVLSYLSEFKPLGNAQKPVTLDFERPLVELEKKIVDVRKMAE
ETGLDFTEQIITLETKYRQALKDLYTHLTPIQRVNIARHPNRPTFLDHIHNITDKFMELH
GDRAGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYYA
DHHGFPIVTFIDTPGAYADLKSEEKGQGEAIANNLRTMFGLKVPILSIVIGEGGSGGALA
IGCANKMLMLENAVFYVASPEACAAILWQTSKAAPEAAEKLRITSKELVNLNVADGIIPE
PLGGAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIEGEPVEPEKK
INMKRRDAVASTSRNLEGEVEKLREQILKAKEASPESDEGEELSSQVLKEMIEKLKSDID
EEYTKAAKAMGLEERLAATREEFSKANAEEHLMHPVLIERIEKLKEEFNARLSEAPNYES
LKAKLDMLKDFSRAKAASDAASVKKEINKRFQEAVERPEVREKVEAVKAEVASSGASSFE
ELSDELKEKVLKTKREVEAEMAVVLKSMGLELEAVKPNLKEVVAESPNENIQEKIEKLNR
EITEKIEEVVRTPEIKSMVELLKVETAKASQMPDQGSQKIEALEMQIKQKIADALSMSGL
QEKQEELEKELAAARELAGEESDESVKEDDDDDEDGSGSGRSEIINPSFA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgtctcattcatccatagcattgggtggagcttccgcttctgcttcggat
tacttgcgtagttcggccaacggtgttactggcgtctcattaagagcccttgggaggagg
acaatggttacagctactacaaggagtagtaacctctatgtaacagcccggctcaagaaa
ggaaagaagttcgatcacccatggccagctaaccctgaccccaacgtcaaaggaggagtc
ttgtcttacctctccgaatttaaacctttggggaatgcacaaaagcctgtcactttggat
ttcgagagaccgcttgttgaactcgagaagaagattgttgatgtgaggaagatggcggaa
gaaaccggtttggactttactgagcagattatcactttggagactaagtatagacaggcg
ttgaaagatctttacacgcatcttactcctatacagcgtgtgaacattgctcgccatccc
aaccgtcctactttccttgatcatatacataacatcactgacaagtttatggagcttcat
ggagaccgggcgggttatgatgaccctgcaattgtgactggtattggaaccatagatggc
aaaagatacatgttcatcggtcaccagaaaggtagaaacaccaaagaaaatataatgcgt
aactttgggatgcctactcctcatggttacaggaaggcactacggatgatgtattacgca
gaccatcacggtttccccattgtgacattcattgacactcctggagcctatgcagacctt
aaatcagaggaaaaaggacagggtgaagcgattgccaacaatctaaggacgatgtttggt
cttaaagtgccgattctttctattgtcattggcgaaggtggttctggtggtgccttagcc
attggctgtgctaataaaatgctgatgctcgaaaacgcagttttctatgttgccagtcca
gaggcatgtgcagcgatcttgtggcagacttccaaggctgctcctgaggctgctgaaaag
cttaggattacctccaaggagctggtcaatcttaatgtagccgatggaatcatacctgaa
cctcttggtggagcccatgctgatccttcatggacatcgcagcagataaagattgctatc
aatgaaaacatgaatgaatttgggaaaatgagtggggaggagctgctgaagcacaggatg
gctaagtaccggaagatcggagtgttcattgagggtgaaccagtagagcctgagaagaaa
atcaacatgaagaggagggacgctgtggcttccaccagccggaacctagagggcgaggtt
gagaagctgagggagcagattctgaaagccaaggaagcctctccagagtctgatgagggt
gaggagctttcgagccaagttcttaaggagatgattgagaaacttaaatcggatatcgac
gaagagtacactaaagctgcgaaagcaatggggttagaggagagactagccgcgacgcgc
gaggagttttcgaaagccaatgcggaggagcatcttatgcacccggtgctcatcgagaga
atcgagaagcttaaagaagaattcaatgcacgtttaagcgaagctcctaactacgagagt
ttaaaagctaagctggacatgttgaaggacttctccagagccaaggcggcctcagacgcc
gcttcggttaagaaggagattaataaacggtttcaggaagctgtggagcgtcctgaggtt
agagagaaggttgaagcggttaaagccgaggttgctagctcgggtgcgtcttctttcgaa
gagttgagcgatgagctgaaagagaaagttttgaagacgaagagggaggttgaagcagag
atggctgttgtgttgaagtcgatgggtctggagctggaggctgtgaaaccgaatctgaag
gaagtagtagccgagtctcctaacgaaaacattcaagaaaagattgagaagctgaaccga
gagatcacggagaagattgaggaggtggtgaggacgccggagatcaagagcatggttgag
ttgctgaaagtggagactgcaaaggcgagccagatgcctgatcaggggagtcagaagatc
gaggcgcttgagatgcagatcaagcagaagatcgctgatgctttgagcatgtctggactg
caggagaaacaagaggagcttgagaaggagcttgcagctgcgcgtgagctagctggagag
gaatcagatgagagtgtgaaggaagatgatgatgacgatgaagatggttcaggatcggga
agatccgagataattaaccctagcttcgcctga

KEGG   Brassica napus (rape): 106368252Help
Entry
106368252         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106368252
   00640 Propanoate metabolism
    106368252
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106368252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 106368252
NCBI-ProteinID: XP_013663620
AA seq 281 aa AA seqDB search
MASSPFSLTSPAASVYGATQTSSQLPLPTTRSRLPRRVSFRLSAKPKLRFLSKPSRSSYP
VVKAQSNQVGGSASSKASAPAKIDEPSAKEKNASSSSSADLATEESISEFLTQVTTLVKL
VDSRDIVELQLKQLDCELVIRKKEALPQPPQSPAPYVMMQQPNQPSYVQSAPPPPAPAAA
SPAPSSTPASSPPPSPPSPAKSSLPTVKSPMAGTFYRSPGPGEPPFIKVGDKVQKGQVLC
IVEAMKLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctccgttctccctcacgtccccggctgcttccgtctatggagccacccaa
acctcgtcgcagttacctctcccaaccactcgctctcgtctacctcgcagagtttccttc
cgtctctccgccaagcctaagcttcgctttctctccaagcctagtcgcagtagctaccct
gtggtgaaagcccaatccaaccaggttggtggcagtgcatcatcaaaagcttcagctcct
gcaaaaattgatgagccatcagctaaagaaaagaatgcttcttcttcttcttcagctgat
ttagctacagaggagtctatctctgagttcttgacccaagtaacaactcttgtcaagctt
gtggattcgagagacattgttgagttgcagttgaaacagctcgactgcgagcttgtcatt
cggaaaaaggaagctttacctcagccgcctcaatcccctgcgccttatgttatgatgcag
caaccaaaccaaccatcttatgtgcaatcagctcctcctcctcctgcacctgctgctgcc
tcacctgcgccttcttctaccccagcctcctcgcctccaccatccccacctagtccggcg
aaatcatcgcttccaactgttaaaagtcccatggcaggcacattctaccgtagtccagga
cctggtgaaccaccctttatcaaggttggagacaaagtgcagaagggacaagttctatgc
atcgttgaagccatgaagttaatgaatgaaatagagtctgatcaaacgggaacggtagtc
gatatcgttgcagaagatggcaagcctgttagccttgacactcctctgtttgtggttcaa
ccgtag

KEGG   Brassica napus (rape): 106368253Help
Entry
106368253         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106368253
   00640 Propanoate metabolism
    106368253
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106368253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 106368253
NCBI-ProteinID: XP_013663621
AA seq 276 aa AA seqDB search
MASSSFSLTSPAASVYGATQASSQRPIPTTRSRLPRSVSFRLSAKPKLRFLSKPSRSSYP
VVKAQSNQVGGNASSKASAPVKIDESSAEEKDSNTSSSAELATEESISEFLTQVTTLVKL
VDSRDIVELQLKQLDCELVIRKKEALPQAQTPAPYVMMQQPNQPSYVQATAPPPPSAPAP
STPASSPPPSPPSPAKSSLPTVKSPMAGTFYRSPGPGEPPFIKVGDKVQKGQVLCIVEAM
KLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttcgttttccctcacgtccccggctgcttccgtctatggagccacccaa
gcctcgtcgcagcgacctatcccaaccacccgctctcgtctccctcgcagtgtctccttc
cgtctctccgccaagcctaagcttcgctttctctccaagcctagtcgcagtagctaccct
gtggtgaaagcccaatctaaccaggttggtggcaatgcgtcatcaaaagcttcagctcct
gtaaaaattgatgagtcatcagctgaagaaaaggattcaaacacttcttcttcagctgag
ttagctacagaggagtctatctctgagtttctgacccaagtaacaactcttgtcaagctt
gtggattctagagacattgttgagttgcagttgaaacagctcgactgtgagcttgttatt
cggaaaaaggaagctttacctcaggcccaaacccctgcgccttatgtgatgatgcagcaa
ccaaaccaaccatcttatgttcaagcaactgctcctcctccgccttctgcacctgcacct
tcaactccagcctcctcgcctccaccatccccacctagtccagcgaaatcatcgcttcca
acggttaaaagtcccatggcaggcactttttaccgtagtccaggacctggtgaaccaccc
tttatcaaggttggagacaaagtgcagaagggacaagttctatgcatcgttgaagccatg
aagctaatgaatgaaatagagtctgatcaaacgggaaccgtagtggatatcgttgcagaa
gatggcaagcctgttagtctcgacactcctctgtttgtggttcaaccgtag

KEGG   Brassica napus (rape): 106372160Help
Entry
106372160         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106372160
   00640 Propanoate metabolism
    106372160
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106372160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106372160
NCBI-ProteinID: XP_013667772
AA seq 260 aa AA seqDB search
MASLSIVPYAKISAPSRRVGSIPGIRRQLKPSGISFHVSHVSQTQSTIWRLHATTNEKVV
SNSTPVTNGGCLNGNVKTNVPEPAAELSDFMSKVSSLLKLVDSRDIVELELKQLDCEIVI
RKKEALQQQATQPPAPVYHSMMPPPPMAGLPMPPSPPVSPPPSPAPSSAAETAKPATAPS
SSHPPLKSPMAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITE
LLAEDGKPVSVDTPLFTIVP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtcgatagtaccttacgccaagatctctgctcctagccggcgggtcgga
tctatccctgggatccgacggcagcttaaacccagtggaatctcttttcacgtctcccat
gtatctcagactcaatctacaatctggaggttgcatgcaacaaccaatgagaaggttgtc
tctaactctacaccagtgactaacggtgggtgtttgaacggaaacgtcaagaccaatgtt
cctgaacccgccgccgagctctctgactttatgtctaaagtctctagtcttcttaagctt
gtggattcgagagatatagtggaacttgagctgaagcagctcgactgtgagattgttatt
cgaaagaaagaagccttgcagcaacaagctacacaaccaccagctccggtttatcactcg
atgatgcctcctcctccaatggcaggccttccaatgcctccatctccaccagtgtctcct
cctccttctcctgctccctcctcagccgctgaaacagcaaaaccagcaactgcgccatca
tcttctcatcctccactgaagagtcctatggctggtactttctacagatctcctggaccc
ggtgaacccccttttgtcaaggttggagataaggtgcagaagggtcaagttgtttgcatt
attgaagctatgaaactgatgaacgagattgaggctgagaagtcaggaaccatcaccgag
ttactggctgaagatggaaaaccggtcagcgttgatacgcctctgtttaccatcgttcct
tga

KEGG   Brassica napus (rape): 106418201Help
Entry
106418201         CDS       T04128                                 

Definition
(RefSeq) biotin carboxylase, chloroplastic
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106418201
   00640 Propanoate metabolism
    106418201
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106418201
Enzymes [BR:bna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     106418201
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106418201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_5 RimK
Motif
Other DBs
NCBI-GeneID: 106418201
NCBI-ProteinID: XP_013714313
AA seq 536 aa AA seqDB search
MDASMITNPKSIVSLPSLFMGRSGGSIRSSQCNVTMGQAVSFPSQKTKTLKVSRNVKRRS
GGGGAFAATCSSGDKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAV
CIGEAPSNQSYLLIPNVLSAAISRGCTMLHPGYGFLAENALFVEMCREHRINFIGPNPDS
IRVMGDKSTARETMKNAGVPTVPGSDGLLQSTEEGVRLANEIGYPVMIKATAGGGGRGMR
LANEPSEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQILADKFGNVVHFGERDC
SIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEM
NTRIQVEHPVTEMIYSVDLIEEQIRVAMGEKLRYTQDEIVLRGHSIECRINAEDPFKGFR
PGPGRITSYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTRERAIERMKRALND
TIITGVPTTIEYHKLILEVEDFKNGKVDTAFIPKHEEELAEPHEIVPVKDLTNVAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttcaatgattactaatcctaaatccattgtctcccttccctctttgttcatg
gggaggtcgggaggtagcattagaagttcccaatgtaatgtcacgatgggacaagcggtt
agcttcccgagccaaaaaaccaaaactttgaaagttagccggaacgtgaagagaaggagt
ggtggtggtggtgcgtttgctgctacttgcagcagtggggataagattcttgtggctaac
agaggtgaaatcgctgtccgtgttatccgaactgctcacgaaatggggatcccttgtgtt
gctgtttactccactatagacaaagatgcactccatgtgaagttggctgatgaagctgtt
tgtattggtgaagctccaagcaaccagtcgtatttgttgataccgaatgttctgtcagct
gcgattagcagaggatgtacgatgctccatcctggatatggattccttgcggagaacgct
ctttttgtagagatgtgtagagaacacaggatcaacttcattggaccaaatcctgatagt
atccgtgtcatgggtgacaaatcaactgccagggagacaatgaaaaatgcaggtgttcct
actgtaccagggagtgatggattattgcagagcacagaagaaggagtcaggcttgccaat
gagattggataccctgtaatgatcaaggcaacagcaggtggtggtggacgtggaatgcgt
cttgctaatgaaccttcagagtttgtgaaactgttgcagcaagcaaagagtgaggccgct
gctgcttttggaaatgatggagtttatctggagaagtacgttcaaaatccccgtcatatt
gagttccagattcttgcagataaatttggtaatgttgttcactttggcgagcgtgactgc
agcatccagagacgtaaccaaaagttgctggaagaagcaccttctcccgcactgacccct
gagctgcgtaaagccatgggtgatgcagcagtggcagcagcagcgtccattggttacatt
ggtgttggtaccgtggagtttcttttggatgagagaggttccttctatttcatggaaatg
aacactagaatccaggtggagcaccctgtgacggagatgatttactccgttgatttgatt
gaagaacagattcgtgttgcaatgggagagaaactgcgttatacacaggatgagattgtg
cttaggggacattctattgaatgtcgtatcaatgcagaagacccatttaaaggattcaga
cctggacctggaaggataacatcgtatctgccatctggaggtccttttgttaggatggat
agccatgtatatccagactatgtcgttcctccaagctatgattctcttcttggaaagctt
attgtatgggctccaacgagggaaagggcgatcgagcggatgaagcgtgcacttaatgac
actattattacaggggttcccaccaccattgagtaccacaagcttatccttgaagttgag
gatttcaaaaacggaaaagttgatacagctttcatccccaagcatgaagaggaattagca
gagcctcatgaaattgtaccagtgaaagatttgacaaatgtagctgcttag

KEGG   Brassica napus (rape): 106420201Help
Entry
106420201         CDS       T04128                                 

Definition
(RefSeq) biotin carboxylase, chloroplastic
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106420201
   00640 Propanoate metabolism
    106420201
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106420201
Enzymes [BR:bna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     106420201
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106420201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_5 RimK
Motif
Other DBs
NCBI-GeneID: 106420201
NCBI-ProteinID: XP_013716504
AA seq 535 aa AA seqDB search
MDASMITNPKSIVSLPSLFMGRSGGSIRSSQCNVTMGQTVSFPRQKTLTLKVSRNVKRKS
GGGAFAATCSSGDKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAVC
IGEAPSNQSYLLIPNVLSAAISRGCTMLHPGYGFLAENALFVEMCREHRINFIGPNPDSI
RVMGDKSTARETMKNAGVPTVPGSDGLLQSTEEGVRLANEIGYPVMIKATAGGGGRGMRL
ANEPSEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQILADKFGNVVHFGERDCS
IQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMN
TRIQVEHPVTEMIYSVDLIEEQIRVAMGEKLRYTQDEIVLRGHSIECRINAEDPFKGFRP
GPGRITSYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTRERAIERMKRALNDT
IITGVPTTIEYHKLILEVEDFKNGKVDTAFIPKHEEELAEPDEIVPVKDLTNVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctcaatgattactaatcccaaatccattgtctcccttccctctttgttcatg
gggaggtcgggaggtagtattagaagttcccaatgtaatgtcactatgggacaaacggtt
agcttcccgaggcaaaagactctgactttaaaagttagccggaacgtgaagagaaaaagt
ggtggtggtgcgtttgctgctacttgtagcagtggggataagattcttgtggctaacaga
ggtgaaatcgctgtccgtgttatccgaacagctcacgaaatggggatcccttgtgttgct
gtttactcaactatagacaaggatgcacttcatgtgaagttggctgatgaagctgtttgt
attggtgaagctcctagcaaccagtcgtatttgttgataccgaatgttctgtcagctgcg
attagcagaggatgtacaatgctccatcctggatatggattccttgcggagaacgctctt
tttgtagagatgtgtagagaacacaggatcaatttcattggaccaaatcctgatagcatc
cgtgtcatgggtgacaaatcaactgctagggagacaatgaaaaatgctggtgtccctact
gtaccagggagtgatggattattgcagagcacagaggaaggagtcaggctcgccaatgag
attgggtaccctgtaatgatcaaggcaacagcaggtggtggtggacgtggaatgcgtctt
gccaatgaaccgtcagagtttgtgaaactgttgcagcaagcaaagagtgaggccgctgct
gcttttggaaatgatggagtttatctggagaagtacgtgcaaaatccccgtcatattgag
ttccagattcttgccgataaatttggtaacgttgttcactttggcgagcgtgactgcagc
atccagaggcgtaaccaaaagttgctggaagaagcaccttctcctgcactgacccctgag
ctgcgaaaagccatgggtgatgcagcagtggcagcagcagcgtccattggttacattggt
gttggtacagtggagtttcttctggatgagagaggttccttctatttcatggaaatgaac
actagaatccaggtggagcaccctgtgacggagatgatttactcagttgatttgattgaa
gaacagatccgtgttgcaatgggagagaaactgcgttatacacaggatgagattgtgctt
agaggacattcgattgagtgtcgtatcaatgcagaagacccatttaaaggattcagacct
ggacctggaagaataacatcgtatctgccatctggaggtccttttgttaggatggatagc
catgtgtatccggactatgttgttcctccaagctatgattctcttcttggaaagcttatt
gtatgggctccaacgagggaaagggcgatcgagcggatgaagcgtgcactcaatgacact
attattacaggggttcccaccaccattgagtaccacaagcttatccttgaagttgaggat
ttcaaaaacggaaaagttgatacagctttcatccccaagcatgaagaggaattagcagag
cctgatgaaattgtcccagtgaaagatttgacaaatgtagctgcttag

KEGG   Brassica napus (rape): 106423632Help
Entry
106423632         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106423632
   00640 Propanoate metabolism
    106423632
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106423632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 106423632
NCBI-ProteinID: XP_013719861
AA seq 281 aa AA seqDB search
MASSPFSLTSPAASVYGATQTSSQLPLPTTRSRLPRRVSFRLSAKPKLRFLSKPSRSSYP
VVKAQSNQVGGSASSKASAPAKIDEPSAKEKNASSSSSADLATEESISEFLTQVTTLVKL
VDSRDIVELQLKQLDCELVIRKKEALPQPPQSPAPYVMMQQPNQPSYVQSAPPPPAPAAA
SPAPSSTPASSPPPSPPSPAKSSLPTVKSPMAGTFYRSPGPGEPPFIKVGDKVQKGQVLC
IVEAMKLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctccgttctccctcacgtccccggctgcttccgtctatggagccacccaa
acctcgtcgcagttacctctcccaaccactcgctctcgtctacctcgcagagtttccttc
cgtctctccgccaagcctaagcttcgctttctctccaagcctagtcgcagtagctaccct
gtggtgaaagcccaatccaaccaggttggtggcagtgcatcatcaaaagcttcagctcct
gcaaaaattgatgagccatcagctaaagaaaagaatgcttcttcttcttcttcagctgat
ttagctacagaggagtctatctctgagttcttgacccaagtaacaactcttgtcaagctt
gtggattcgagagacattgttgagttgcagttgaaacagctcgactgcgagcttgtcatt
cggaaaaaggaagctttacctcagccgcctcaatcccctgcgccttatgttatgatgcag
caaccaaaccaaccatcttatgtgcaatcagctcctcctcctcctgcacctgctgctgcc
tcacctgcgccttcttctaccccagcctcctcgcctccaccatccccacctagtccggcg
aaatcatcgcttccaactgttaaaagtcccatggcaggcacattctaccgtagtccagga
cctggtgaaccaccctttatcaaggttggagacaaagtgcagaagggacaagttctatgc
atcgttgaagccatgaagttaatgaatgaaatagagtctgatcaaacgggaacggtagtc
gatatcgttgcagaagatggcaagcctgttagccttgacactcctctgtttgtggttcaa
ccgtag

KEGG   Brassica napus (rape): 106424680Help
Entry
106424680         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106424680
   00640 Propanoate metabolism
    106424680
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106424680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106424680
NCBI-ProteinID: XP_013720889
UniProt: G4WXE1
AA seq 252 aa AA seqDB search
MASLSVPYAKISAPNRRVESIPGIRRQPQPSGISFHVSHVSQTQSTIWRLRATTNEVVSN
STPVTNGGCLNGNVKTNVPPEPAAELSDFISKVSGLLKLVDSRDIVELELKQLDCEIVIR
KKEALPQQPAPVYHSMMPPPPMEGLPMPPSPPVSPPAPSSAPATANTATAPSSSHPPLKS
PMAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITELLAEDGKP
VSVDTPLFTIAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtcggttccttacgccaagatctctgctcctaaccggcgggtcgaatct
attcctgggatccgacggcagcctcaacccagtgggatctcttttcacgtctcccatgta
tctcagactcaatctacaatctggaggttgcgtgccacaaccaatgaggttgtgtctaat
tctacaccagtgactaacggtggatgtttgaacggaaacgtcaagaccaatgttcctcct
gaacccgccgccgagctctctgactttatctctaaagtctctggtcttcttaagcttgtg
gattcaagagatatagtggaacttgagttgaagcagctcgactgtgagattgttattcgg
aagaaggaagccttaccgcagcaaccagctccagtttatcactcgatgatgcctcctcct
ccaatggaaggccttccaatgcctccatctccaccagtgtctcctcctgctccctcctca
gctcctgcaacagcgaatacagcaaccgcaccatcctcttctcatcctccactgaagagt
cctatggctggtactttctacaggtctcctggacccggtgaacctccttttgtcaaggtc
ggagataaagtgcagaagggtcaagttgtttgcattatcgaagctatgaaactgatgaat
gagattgaggctgagaagtcaggaaccatcactgaattactggctgaagatggaaaaccc
gtcagcgttgatacgcctctgtttaccatcgctccttga

KEGG   Brassica napus (rape): 106424730Help
Entry
106424730         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106424730
   00640 Propanoate metabolism
    106424730
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106424730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106424730
NCBI-ProteinID: XP_013720931
UniProt: G4WXE1
AA seq 252 aa AA seqDB search
MASLSVPYAKISAPNRRVESIPGIRRQPQPSGISFHVSHVSQTQSTIWRLRATTNEVVSN
STPVTNGGCLNGNVKTNVPPEPAAELSDFISKVSGLLKLVDSRDIVELELKQLDCEIVIR
KKEALPQQPAPVYHSMMPPPPMEGLPMPPSPPVSPPAPSSAPATANTATAPSSSHPPLKS
PMAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITELLAEDGKP
VSVDTPLFTIAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtcggttccttacgccaagatctctgctcctaaccggcgggtcgaatct
attcctgggatccgacggcagcctcaacccagtgggatctcttttcacgtctcccatgta
tctcagactcaatctacaatctggaggttgcgtgccacaaccaatgaggttgtgtctaat
tctacaccagtgactaacggtggatgtttgaacggaaacgtcaagaccaatgttcctcct
gaacccgccgccgagctctctgactttatctctaaagtctctggtcttcttaagcttgtg
gattcaagagatatagtggaacttgagttgaagcagctcgactgtgagattgttattcgg
aagaaggaagccttaccgcagcaaccagctccagtttatcactcgatgatgcctcctcct
ccaatggaaggccttccaatgcctccatctccaccagtgtctcctcctgctccctcctca
gctcctgcaacagcgaatacagcaaccgcaccatcctcttctcatcctccactgaagagt
cctatggctggtactttctacaggtctcctggacccggtgaacctccttttgtcaaggtc
ggagataaagtgcagaagggtcaagttgtttgcattatcgaagctatgaaactgatgaat
gagattgaggctgagaagtcaggaaccatcactgaattactggctgaagatggaaaaccc
gtcagcgttgatacgcctctgtttaccatcgctccttga

KEGG   Brassica napus (rape): 106426876Help
Entry
106426876         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106426876
   00640 Propanoate metabolism
    106426876
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106426876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106426876
NCBI-ProteinID: XP_013723061
AA seq 256 aa AA seqDB search
MASLSVPYAKISAPNRRVGSIPGRTRWQPQLNGVSFPSDVSQNQSTIWRLRATTNEVVSN
STPVTNGGCLNGNVKSNVPESAKLSNFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKK
EALQQQPTPPPAPVYHSMPPPMAGLQMAPSQPVAPPPFSPSPSSAPETAKPVTPPSSSHP
PLKSPMAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITELLAE
DGKPVSVDTPLFTIVP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtctgtaccttacgccaagatctctgccccaaaccgtcgggttggatct
attcctggaagaacccgatggcagccgcaactcaatggcgtctcctttccttccgatgta
tctcagaatcaatctacaatctggaggttgcgtgcgacaaccaacgaggttgtctctaac
tctaccccagtgactaacggtgggtgcttgaacgggaacgtgaagagcaatgttcctgaa
tccgctaaactctctaactttatggctaaagtttcaggtcttcttaagcttgtggattca
agagatatagtggaacttgaacttaagcagctcgactgtgagattgttattcgaaagaag
gaagctttacagcagcaacctacaccaccaccagctccagtttatcactccatgcctcct
ccaatggcaggccttcaaatggctccatctcaaccagttgctcctcctcctttttctcct
agtccctcctcagcccctgaaacagcaaaaccagtaaccccaccttcctcttcacatcct
ccactcaagagtcctatggctggtactttctacagatctcctggtcctggtgaacctcct
tttgtcaaggttggagataaggtgcagaagggtcaagttgtttgcattattgaagctatg
aaactcatgaatgagattgaggctgagaaatcaggaaccatcactgaactactagctgaa
gatggaaaaccggttagcgttgacacgcctctgtttaccatcgtgccttga

KEGG   Brassica napus (rape): 106427748Help
Entry
106427748         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic-like
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106427748
   00640 Propanoate metabolism
    106427748
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106427748
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106427748
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106427748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 106427748
NCBI-ProteinID: NP_001302844
UniProt: Q6QIW1
AA seq 764 aa AA seqDB search
MASMSHSSIALCGASASASASDHLRSSTNGVSLRTLGRAMVASTKRNNLYVTARLKKGKK
FDHPWASNPDPNVKGGVLSYLSTFKPLGDTQKPVTLDFEKPLVELEKKIVDVRKMAAETG
LDFTDQIITLGTKYRQALKDLYTDLTPIQRVNIARHPNRPTFLDHIHNITDKFMELHGDR
AGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYYADHH
GFPIVTFIDTPGAYADLKSEELGQGEAIANNLRTMFGLKVPILSIVIGEGGSGGALAIGC
ANKMLMLENAVFYVASPEACAAILWNSSKAAPEAAEKLRITSRELVKLNVADGIIPEPLG
GAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIENAPVEPEIKVNM
KRRDAVVSNSRKLEGEVEKLKEQILKAKETSSSEDQPSSEVLNEMIKKLKSEIDDEYTEA
ARTMGLEERLTAMRGEFSKASEEEHLVHPILIEKIEKLKEEFNTRLSEAPNYESLKSKLD
MLRDFSRAKAALEAASVKNEINKRFQEAVDRPEVREKVEAIKAEVASSGASSFEELSDEL
KEKVLKTKGEVEAEMAGVLKSMALELEAVKPNVAEQIFVPSENIQEKVEKLNREISEKIE
EVVRAPEIKSMVELLKVENAKASQTPGDTKVSQKIETLEQQIKQKIADALSMSGLQEKQE
ELEKELAVAREVAAVKSEESLKEDDDDDDGSESEKPEIINPHFA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatgtctcattcatccatagcattgtgtggagcttctgcttctgcttctgct
tcggaccacctgcgtagttcgaccaatggtgtctcactgagaacccttgggagagcaatg
gttgcatccaccaaaagaaacaacctgtacgtgacagctcgcctcaagaaaggcaaaaag
ttcgatcacccctgggcttccaaccccgacccgaacgtcaaaggaggggtcttgtcttac
ctctccactttcaaacccttgggggacacccaaaagcccgtcactcttgatttcgagaag
ccactcgttgagctcgagaagaagattgtcgatgtgaggaagatggcggctgaaactggt
ttggacttcactgatcagatcatcactttggggaccaagtatagacaggcgctgaaggat
ctttacacggatctcacaccgatacagcgcgtgaacattgcacgacatcccaaccgtcct
actttccttgatcatatacataacatcactgacaagtttatggagcttcatggagaccgg
gcggggtatgatgatccagccattgtgactggtattggaaccatagatgggaaacgttac
atgttcattggtcaccagaaagggagaaacaccaaagagaatataatgcgtaactttggg
atgcctactcctcatggttataggaaggcgttacggatgatgtattacgcagaccatcat
ggtttccccattgtgactttcatcgacactcctggagcctatgcagatcttaaatctgag
gaacttggacagggtgaagcgattgccaacaatctgaggacaatgttcggcttgaaagtg
ccgattctttctattgtcattggagaaggtggttctggaggtgccttggctattggctgt
gctaataaaatgctgatgcttgaaaacgctgttttctatgttgccagtccagaggcatgt
gcagcgatcttgtggaatagttccaaggctgctcctgaggctgctgaaaagcttagaatt
acctccagggagttggttaagcttaatgtagccgatggaatcatacctgaacctcttggt
ggtgctcatgctgatccttcatggacgtcgcagcagataaagattgctatcaatgaaaac
atgaatgaatttggaaaaatgagtggggaggagctgttgaagcacaggatggctaagtac
agaaagattggagtgttcattgagaatgcgccagtagagccagagattaaagtcaacatg
aagaggagagatgctgtggtctccaatagccggaagctggagggcgaggtcgagaagcta
aaggagcagatactgaaagcgaaggagacctcttcttcagaggaccagccttcaagtgaa
gttcttaacgagatgattaagaaacttaaatcagagatcgatgatgagtacactgaagct
gcaagaacaatgggtttggaggagagactaacagcaatgcgcggagagttctcaaaggcc
agtgaagaggagcatcttgtccaccctattctgattgagaagattgagaagcttaaagaa
gagttcaacacacgtttgagtgaagcacctaactacgagagcctcaaatctaagctggac
atgttgagagacttttcaagagccaaggcagctttagaagctgcttcagtgaagaatgag
atcaataagcggtttcaagaagctgtggaccgtcctgaagttagagagaaggttgaggcg
atcaaagccgaggtggcaagctcaggagcatcatcttttgaagagctgagtgatgagcta
aaggaaaaagttttgaagacgaaaggggaggtggaagctgagatggctggtgtgttgaag
tcaatggccctagagcttgaggctgtgaaaccgaatgtggctgagcagatctttgttccg
agcgaaaacattcaagagaaagttgaaaagctgaaccgagagatcagtgagaagattgag
gaggtggtgagggcaccagagatcaagagcatggttgagttgctgaaagtggagaacgca
aaggcgagtcagacgccaggtgatactaaagtgagtcagaagatagagactcttgagcag
cagatcaagcagaagattgcagatgctttgagcatgtcaggactgcaggaaaagcaagag
gagcttgagaaggagctcgcggttgcacgtgaagtagctgcagtgaaatcagaggagagc
ttgaaggaagatgatgatgatgatgatggttcagagtcggagaaaccagagatcattaac
ccccacttcgcttga

KEGG   Brassica napus (rape): 106431970Help
Entry
106431970         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106431970
   00640 Propanoate metabolism
    106431970
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106431970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106431970
NCBI-ProteinID: XP_013728269
AA seq 251 aa AA seqDB search
MASLSVPYAKISASNRRVGSIPGIRRQPQLNAVSFPSDVSQTQSTTWKLRATTNEVVSNS
TPVTNGGCLNGNVKSNVPESAELSDFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKE
ALAAPPAPVYHSMPPPMAGFPMAPSHPVAPPPFSPSPSSAPETAKPVTPPSSSHPPLKSP
MAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITELLAEDGKPV
SVDTPLFTIVP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtccgtaccttacgccaagatctcagcctcaaaccgtcgggtaggatca
attcctggaatccgacggcagccacaactcaatgctgtctcctttccctcggatgtatct
cagactcaatctacaacttggaagttgcgtgcgacaaccaacgaggttgtctctaactct
accccagtgactaacggtgggtgcttgaacgggaacgtgaagagcaatgttcctgaatcc
gctgaactctctgactttatggctaaagtttcaggtcttcttaagcttgtggattcaaga
gatatagtggaacttgaactgaagcagcttgactgtgagattgttattcggaaaaaggaa
gctttagctgcaccaccagctccagtctatcactctatgcctcctccaatggcaggcttt
ccaatggctccatctcatccagttgctcctcctcctttttctcctagtccctcctcagcc
cctgaaacagcaaaaccagtaaccccaccttcctcttcacatcctccactcaagagtcct
atggctggtactttctacagatctcctggtcctggtgaacctccttttgtcaaggttgga
gataaggtgcagaagggtcaagttgtttgcattattgaagctatgaaactcatgaatgag
attgaggctgagaaatcaggaaccatcactgaactactagctgaagatggaaaaccggtt
agcgttgacacgcctctctttaccatcgtgccttga

KEGG   Brassica napus (rape): 106432607Help
Entry
106432607         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106432607
   00640 Propanoate metabolism
    106432607
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106432607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 106432607
NCBI-ProteinID: XP_013728908
AA seq 256 aa AA seqDB search
MASLSVPYAKISAPNRRVGSIPGRTRWQPQLNGVSFPSDVSQNQSTIWRLRATTNEVVSN
STPVTNGGCLNGNVKSNVPESAKLSNFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKK
EALQQQPTPPPAPVYHSMPPPMAGLQMAPSQPVAPPPFSPSPSSAPETAKPVTPPSSSHP
PLKSPMAGTFYRSPGPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEAEKSGTITELLAE
DGKPVSVDTPLFTIVP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgtctgtaccttacgccaagatctctgccccaaaccgtcgggttggatct
attcctggaagaacccgatggcagccgcaactcaatggcgtctcctttccttccgatgta
tctcagaatcaatctacaatctggaggttgcgtgcgacaaccaacgaggttgtctctaac
tctaccccagtgactaacggtgggtgcttgaacgggaacgtgaagagcaatgttcctgaa
tccgctaaactctctaactttatggctaaagtttcaggtcttcttaagcttgtggattca
agagatatagtggaacttgaacttaagcagctcgactgtgagattgttattcgaaagaag
gaagctttacagcagcaacctacaccaccaccagctccagtttatcactccatgcctcct
ccaatggcaggccttcaaatggctccatctcaaccagttgctcctcctcctttttctcct
agtccctcctcagcccctgaaacagcaaaaccagtaaccccaccttcctcttcacatcct
ccactcaagagtcctatggctggtactttctacagatctcctggtcctggtgaacctcct
tttgtcaaggttggagataaggtgcagaagggtcaagttgtttgcattattgaagctatg
aaactcatgaatgagattgaggctgagaaatcaggaaccatcactgaactactagctgaa
gatggaaaaccggttagcgttgacacgcctctgtttaccatcgtgccttga

KEGG   Brassica napus (rape): 106438168Help
Entry
106438168         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic isoform X1
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106438168
   00640 Propanoate metabolism
    106438168
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106438168
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106438168
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106438168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans BTV_NS2
Motif
Other DBs
NCBI-GeneID: 106438168
NCBI-ProteinID: XP_013734703
AA seq 768 aa AA seqDB search
MASMSHSSIALCGASASASDHLRSSTNGVTGVSLRTLGRAMVASTKRSNLYVTARLKKGK
KFDHPWPSNPDPNVKGGVLSYLSTFKPLGDTQKPVTLDFEKPLVELEKKIVDVRKMAAET
GLDFTDQIITLETKYRQALKDLYTHLTPIQRVNIARHPNRPTFLDHIHNITDKFMELHGD
RAGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYYADH
HGFPIVTFIDTPGAYADLKSEELGQGEAIANNLRTMFGLKVPILSIVIGEGGSGGALAIG
CANKMLMLENAVFYVASPEACAAILWNSSKAAPEAAEKLRITSRELVKLNVADGIIPEPL
GGAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIENAPVEPEIKVN
MKRRDAVISNSRKLEGEVEKLRDQILKAKETSSEEAPSSEVLNEMIKKLKSEIDDEYTEA
ARAMGLEERLTAMRGEFSKASAEEHLMHPILIEKIEKLKEEFNTRLSEAPNYESLKSKLD
MLRDFSRAKAASEAASVRNEINKRFQEAVDRPEVREKVEAIKAEVASSGASSFEELSDEL
KEKVLKTKGEVEAEMAGVLKSMGLELEAVKPNVAEQIFVPSENIQEKVEKLNREISEKIE
EVVRTPEIKSMVELLKVENAKASQTPGDTKVSQKIETLEQQIKQKIADALSMSGLQEKQE
ELEKELAVARELAAEKSQESLKEDDDDDDDDEDGSESEKPEIINPSFA
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatgtctcattcatccatagcattgtgtggagcttctgcttctgcttcagac
cacctgcgtagttcgaccaatggtgtcactggggtctcattgagaaccctaggaagagca
atggttgcatccaccaaaagaagcaacctgtacgtgacagctcggctcaagaaaggcaag
aagttcgatcacccctggccttccaaccctgacccgaacgtcaaaggaggagtcttgtct
tacctctccactttcaaacccttgggggacactcaaaagcccgtcactcttgatttcgag
aagccactcgttgaactcgagaagaagattgtcgatgtgaggaagatggcggctgaaact
ggtttggacttcactgatcagatcatcactttggaaaccaagtatagacaggcgctgaag
gatctttacacgcatctcacaccgatacagcgcgtgaacattgcacgacatcccaaccgt
cctactttccttgatcatatacataacatcactgacaagtttatggagcttcatggagac
agggcgggttatgatgatccagccattgtgactggtattggaaccatagatgggaaacgt
tatatgttcattggtcaccagaaaggaagaaacaccaaagagaatataatgcgtaacttt
gggatgcctactcctcatggttataggaaggcgttacggatgatgtattacgcagaccat
catggtttccccattgtgactttcatcgacactcctggagcctatgcagatcttaaatct
gaggaacttggacagggtgaagcgattgccaacaatctgaggacaatgttcggcttgaaa
gtgccgattctttctattgtcattggagaaggtggttctggaggtgccttggctattggc
tgtgctaataaaatgctgatgcttgaaaacgctgttttctatgttgccagtccagaggca
tgtgcagcgatcttgtggaatagttccaaggctgctcctgaggctgctgaaaagcttaga
attacctccagggagttggttaagcttaatgtagccgatggaatcatacctgaacctctt
ggtggtgctcatgctgatccttcatggacgtcgcagcagataaagattgctatcaatgaa
aacatgaatgaatttggaaaaatgagtggggaggagctgctgaagcacaggatggctaag
tacagaaagattggagtgttcattgagaatgctcctgtagagccagagattaaagtcaac
atgaagaggagagacgctgtgatctccaatagccggaagctggagggggaagttgagaag
ctaagagaccagattctgaaagccaaggagacttcttcagaggaagcgccgtctagtgaa
gttcttaacgagatgattaagaaacttaagtcagagatagatgatgagtacactgaagct
gcaagagcaatgggtttggaggagagactaacagcaatgcgcggagaattctcaaaggcg
agtgcagaggagcatcttatgcatcctattctgatagagaagattgagaagcttaaagaa
gagttcaatacacgtttgagtgaagcacctaactacgagagcctcaaatctaagcttgac
atgttgagagacttttcaagagccaaggcagcttcagaagctgcttcagtgagaaatgag
atcaataagcggtttcaagaagctgtggaccgtcctgaagttagagagaaggttgaggcg
atcaaagccgaggttgcgagctcaggagcatcatcttttgaagagctgagtgatgagctg
aaggaaaaagttttgaagacgaaaggggaggtcgaagcagagatggctggtgtgttgaag
tcaatgggcctagagcttgaggctgtgaaaccgaatgtggctgagcagatctttgttccg
agcgaaaacattcaagagaaagttgaaaagctgaaccgagagatcagtgagaagattgag
gaggtggtgaggacgccagagatcaagagcatggtggagttgctgaaagtggagaacgca
aaggcgagtcagacgccaggtgatactaaagtgagtcagaagatagagactcttgagcag
cagatcaagcagaagattgcagatgctttaagcatgtcaggactgcaggaaaagcaagag
gagcttgagaaggagctcgcggttgcacgtgaattagctgcagagaaatcacaggagagc
ctgaaggaagatgatgatgatgatgatgacgatgaagacggttcagaatctgagaaacca
gagatcattaaccccagcttcgcctga

KEGG   Brassica napus (rape): 106451057Help
Entry
106451057         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106451057
   00640 Propanoate metabolism
    106451057
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106451057
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106451057
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106451057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 106451057
NCBI-ProteinID: XP_013748367
AA seq 769 aa AA seqDB search
MASMSHSSIALGGASASASDYLRSSANGVTGVSLRALGRRTMVTATTRSSNNLYVTARLK
KGKKFDHPWPANPDPNVKGGVLSYLSDFKPLGNAQKPVTLDFERPLVELEKKIVDVRKMA
EETGLDFTEQIITLETKYRQALKDLYTHLTPIQRVNIARHPNRPTFLDHIHNITDKFMEL
HGDRAGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYY
ADHHGFPIVTFIDTPGAYADLKSEEKGQGEAIANNLRTMFGLKVPILSIVIGEGGSGGAL
AIGCANKMLMLENAVFYVASPEACAAILWQTSKAAPEAAEKLRITSKELVNLNVADGIIP
EPLGGAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIEGEPVEPEK
KINMKRRDAVASTSRNLEGEVEKLREQILKAKEASPESEVELSSEVLNEMIEKLKSDIDE
EYTKAAKAMGLEERLAATREEFSKANAEEHLMHPVLIERIEKLKEEFNARLSEAPNYESL
KAKLDMLKDFSRAKAASEAASVKKEIDKRFREAVERPEVREKVEAVKAEVASSGASSFEE
LSDELKEKVLKTKREVEAEMAVVLKSMGLELEAVKPNLKEVVAESPNENIQEKLEKLNRE
INEKIEEVVRTPEIKSMVELLKVETAKASRMPDQGSQKIEALEMQIKQKIADALSMSGLQ
EKQEELEKELAAARELAGEESDESVKEDDDDDEDGSGSGRSEIINPSFA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatgtctcattcatccatagcattgggtggagcttccgcttctgcttcggat
tacttgcgtagttcggccaacggtgtcactggcgtctcattaagagcccttgggaggaga
acaatggttacagctactacaaggagtagtaacaacctctacgtgacagctcggctcaag
aaaggcaagaagttcgatcacccctggcctgctaaccctgaccccaacgtcaaaggagga
gtcttgtcttacctctccgactttaaacctttggggaacgctcaaaagcctgtcactttg
gatttcgagagaccgcttgttgaactcgagaagaagattgttgatgtgaggaagatggcg
gaagaaaccggtttggactttactgagcagattatcactttggagactaagtatagacag
gcgttgaaagatctttacacgcatcttactcctatacagcgtgtgaacattgctcgccat
cccaaccgtcctactttccttgatcatatacataacatcactgacaagtttatggagctt
catggagaccgggcggggtatgatgatccagccattgtgactggtattggaaccatagat
ggcaaaagatacatgttcatcggtcaccagaaaggtagaaacaccaaagagaatataatg
cgtaactttgggatgcctactcctcatggttacaggaaggcactacgaatgatgtattac
gcagaccatcacggtttccccattgttacattcattgacactcctggagcctatgcagac
cttaaatccgaggaaaaaggacagggtgaagcgattgccaacaatctaaggacaatgttt
ggtctgaaagtgccaattctttctattgtcattggcgaaggtggttctggtggtgcctta
gccattggatgtgctaataaaatgttgatgctcgaaaacgcagttttctatgttgccagt
ccagaggcctgtgcagcgatcttgtggcagacgtccaaggctgctcctgaggctgctgaa
aagcttaggattacctccaaggagctggtcaatcttaatgtagccgatggaatcatacct
gaacctcttggtggagcccatgctgatccttcatggacatcgcagcagataaagattgct
atcaatgaaaacatgaatgaatttgggaaaatgagtggggaggagctgctgaagcacagg
atggctaagtaccgaaagatcggagtgttcattgagggtgaaccagtagagcctgagaag
aaaatcaacatgaagaggagagacgctgtggcctccaccagccggaacctagagggcgag
gttgagaagctgagggagcagattctgaaagccaaggaagcctctccagagtctgaggtg
gagctttcgagtgaagttcttaacgagatgattgagaaacttaaatcggatatcgacgaa
gagtacactaaagccgcaaaggcaatggggttagaggagaggctagccgcgacgcgggag
gagttctccaaagccaatgcagaggagcatcttatgcacccggtgctcattgagagaatc
gagaagcttaaagaagaattcaatgctcgtttgagcgaagctcctaactacgagagttta
aaagctaagctggacatgttgaaggacttctccagagccaaggcggcctcagaagccgct
tcggtgaagaaggagattgataagaggtttcgggaagctgtggagcgtcctgaggtcaga
gagaaggttgaagcggttaaagccgaggttgctagctcaggtgcgtcttcttttgaagag
ttgagcgatgagctgaaagagaaagttttgaagacgaagagggaggttgaagcagagatg
gctgttgtgttgaagtcaatgggtctggagctggaggctgtgaaaccgaatctgaaggag
gtagtagctgagtctccgaacgaaaacattcaagagaagcttgagaagctgaaccgagag
atcaacgagaagattgaggaggtggtgaggacgccggagatcaagagcatggttgagttg
ctgaaagtggagaccgcaaaggcgagccggatgcctgatcaggggagtcagaagatcgag
gcgcttgagatgcagatcaagcagaagatagctgatgctttgagcatgtcgggactgcag
gagaaacaagaggagcttgagaaggagcttgcagctgcacgtgagctagctggagaggag
tcagatgagagtgtgaaggaagatgatgatgatgatgaagatggttcaggatccgggaga
tcagagataattaaccccagcttcgcctga

KEGG   Brassica napus (rape): 106451060Help
Entry
106451060         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic-like
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106451060
   00640 Propanoate metabolism
    106451060
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106451060
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     106451060
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     106451060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE COG5
Motif
Other DBs
NCBI-GeneID: 106451060
NCBI-ProteinID: XP_022568514
AA seq 656 aa AA seqDB search
MQVRKMAAETGLDFTDQIITLETKYRQALKDLYTHLTPIQRVNIARHPNRPTFLDHIHNI
TDKFMELHGDRAGYDDPAIVTGIGTIDGKRYMFIGHQKGRNTKENIMRNFGMPTPHGYRK
ALRMMYYADHHGFPIVTFIDTPGAYADLKSEELGQGEAIANNLRTMFGLKVPILSIVIGE
GGSGGALAIGCANKMLMLENAVFYVASPEACAAILWNSSKAAPEAAEKLRITSKELVNLN
VADGIIPEPLGGAHADPSWTSQQIKIAINENMNEFGKMSGEELLKHRMAKYRKIGVFIEG
EPVEPEKKINMKRRDAVASTSRNLEGEVEKLREQILKAKEASPESEVELSSEVLNEMIEK
LKSDIDEEYTKAAKAMGLEERLAATREEFSKANAEEHLMHPVLIERIEKLKEEFNARLSE
APNYESLKAKLDMLKDFSRAKAASEAASVKKEIDKRFREAVERPEVREKVEAVKAEVASS
GASSFEELSDELKEKVLKTKREVEAEMAVVLKSMGLELEAVKPNLKEVVAESPNENIQEK
LEKLNREINEKIEEVVRTPEIKSMVELLKVETAKASRMPDQGSQKIEALEMQIKQKIADA
LSMSGLQEKQEELEKELAAARELAGEESDESVKEDDDDDEDGSGSGRSEIINPSFA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaggaagatggcggctgaaactggtttggacttcactgatcagatcatcact
ttggaaaccaagtatagacaggcgctgaaggatctttacacgcatctcacaccgatacag
cgcgtgaacattgcacgacatcccaaccgtcctactttccttgatcatatacataacatc
actgacaagtttatggagcttcatggagaccgggcggggtatgatgatccagccattgtg
actggtattggaaccatagatgggaaacgttacatgttcattggtcaccagaaaggaaga
aacaccaaagagaatataatgcgtaactttgggatgcctactcctcatggttacaggaag
gcgttacggatgatgtattacgcagaccatcatggtttccccattgtgacgttcatcgac
actcctggagcctatgcagatcttaaatctgaggaactcggacagggtgaagcgattgcc
aacaatctgaggacaatgttcggcttgaaagtgccgattctttctattgtcattggagaa
ggtggttctggaggtgccttggctattggctgtgctaataaaatgctgatgcttgaaaac
gctgttttctatgttgccagtccagaggcatgtgcagcgatcttgtggaatagttccaag
gctgctcctgaggctgctgaaaagcttaggattacctccaaggagctggtcaatcttaat
gtagccgatggaatcatacctgaacctcttggtggagcccatgctgatccttcatggaca
tcgcagcagataaagattgctatcaatgaaaacatgaatgaatttgggaaaatgagtggg
gaggagctgctgaagcacaggatggctaagtaccgaaagatcggagtgttcattgagggt
gaaccagtagagcctgagaagaaaatcaacatgaagaggagagacgctgtggcctccacc
agccggaacctagagggcgaggttgagaagctgagggagcagattctgaaagccaaggaa
gcctctccagagtctgaggtggagctttcgagtgaagttcttaacgagatgattgagaaa
cttaaatcggatatcgacgaagagtacactaaagccgcaaaggcaatggggttagaggag
aggctagccgcgacgcgggaggagttctccaaagccaatgcagaggagcatcttatgcac
ccggtgctcattgagagaatcgagaagcttaaagaagaattcaatgctcgtttgagcgaa
gctcctaactacgagagtttaaaagctaagctggacatgttgaaggacttctccagagcc
aaggcggcctcagaagccgcttcggtgaagaaggagattgataagaggtttcgggaagct
gtggagcgtcctgaggtcagagagaaggttgaagcggttaaagccgaggttgctagctca
ggtgcgtcttcttttgaagagttgagcgatgagctgaaagagaaagttttgaagacgaag
agggaggttgaagcagagatggctgttgtgttgaagtcaatgggtctggagctggaggct
gtgaaaccgaatctgaaggaggtagtagctgagtctccgaacgaaaacattcaagagaag
cttgagaagctgaaccgagagatcaacgagaagattgaggaggtggtgaggacgccggag
atcaagagcatggttgagttgctgaaagtggagaccgcaaaggcgagccggatgcctgat
caggggagtcagaagatcgaggcgcttgagatgcagatcaagcagaagatagctgatgct
ttgagcatgtcgggactgcaggagaaacaagaggagcttgagaaggagcttgcagctgca
cgtgagctagctggagaggagtcagatgagagtgtgaaggaagatgatgatgatgatgaa
gatggttcaggatccgggagatcagagataattaaccccagcttcgcctga

KEGG   Brassica napus (rape): 111204323Help
Entry
111204323         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111204323
   00640 Propanoate metabolism
    111204323
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111204323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H ATP-synt_ab_Xtn PYNP_C
Motif
Other DBs
NCBI-GeneID: 111204323
NCBI-ProteinID: XP_022554431
AA seq 125 aa AA seqDB search
MMQQPNQSSYVQSVAPPPPPSAPAASPAPSAPASLPSPSPPAPAKSSLPTVKSPMAGTFY
RSPGPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDQTGTVVDIVAEDGKPVSLDTPL
FVVQP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcaaccaaaccaatcatcttatgtgcaatcagtggctcctcctcctcctcct
tctgcacctgctgcatcacctgcaccttctgctccagcttctttgccttcaccatctcca
cctgctccagctaaatcatcgcttcctactgttaaaagccctatggctggcacattctac
cgtagtcctggacctggtgaaccaccctttattaaggttggagataaagtgcagaagggg
caagttctatgcatcgttgaagccatgaaattgatgaatgaaatagagtctgaccaaacg
ggaaccgtagtggatatcgttgcagaagatggcaagcctgttagcctcgacactcctctg
tttgtggttcaaccgtag

KEGG   Brassica napus (rape): 111211003Help
Entry
111211003         CDS       T04128                                 

Definition
(RefSeq) biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111211003
   00640 Propanoate metabolism
    111211003
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111211003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 111211003
NCBI-ProteinID: XP_022567554
AA seq 275 aa AA seqDB search
MASSSFSVTSPAASVYAVTQTSSHLPLPTTRSRLPRRVSFRLSAKLRFLSKPIRSSYPVV
KAQSNKVGSGASSNASAPEKTEGKDENSSKDPSSSTDLATEESISEFLTQVTTLVKLVDS
RDIVELQLKQLDCELVIRKKEALPQPESPAQYVMMQQPNQSSYVQSVAPPSAPAASPAPS
TPASSPTPSPPTPAKSSLPTVKSPMAGTFYRSPGPGEPPFIKVGDKVQKGQVLCIVEAMK
LMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttcgttctccgtcacgtctccagctgcttccgtctatgcagtcacccaa
acatcttcacacttgcctctcccaaccacacgctctcgtctccctcgcagagtttcattc
cgtctctccgccaagctccgctttctctccaagcctattcgcagtagctaccctgttgtg
aaagcccaatctaacaaggttggtagcggtgcatcatcaaatgcttcagctcctgaaaag
actgaaggaaaggatgaaaactcatcgaaagacccttcttcttcgactgatttagctaca
gaagagtctatctctgagttccttacccaagtaacaactctcgtcaagcttgtggattcg
agagacattgtggagttgcagttgaaacaactcgactgtgaacttgtcattcgaaaaaag
gaagctttgccacaacccgagtcccctgcgcaatatgttatgatgcagcaaccaaaccaa
tcatcttatgtgcaatcagtggctcctccttctgcacctgctgcatcaccagcaccttct
actcctgcctcttcacctacaccatctccacctactccagctaaatcatcgcttcctact
gttaaaagccccatggctggcacattctaccgtagtccaggacctggcgaaccacccttt
attaaggttggagacaaagtgcagaaggggcaagttctatgcatcgttgaagctatgaag
ttaatgaatgaaatagagtctgaccaaacgggaaccgtagtggatatcgttgcagaagat
ggcaagcctgttagcctcgacactcctctgtttgtggttcaaccgtag

KEGG   Brassica napus (rape): 11542019Help
Entry
11542019          CDS       T04128                                 

Gene name
accD, BRNAC_p030
Definition
(RefSeq) acetyl-CoA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00620  Pyruvate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01212  Fatty acid metabolism
Module
bna_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    11542019 (accD)
   00640 Propanoate metabolism
    11542019 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    11542019 (accD)
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     11542019 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     11542019 (accD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans DUF2321 DUF3027
Motif
Other DBs
NCBI-GeneID: 11542019
NCBI-ProteinID: YP_005089961
UniProt: D1L8P7
Position
CP
AA seq 489 aa AA seqDB search
MEKSWFNLMFSKGELEYRGELSKAMDSFAPIEKTTISKDRFIYDMDKNFYGWGERSSYYN
NVDLLVNSKDIRNFISDDTFFVRDSNKNSYSIYFDIKKKKFEINNDLSDLEIFFYSYCSS
SYLNNRSKGDNDLHYDPYIKDTKYNCNNHINSCIDSYFRSHICINSHFLSDSNNSNESYI
YNFICSESGSGKIRESKNDKIRTNSNRNNLMSSKDFDITKNYNQLWIQCDNCYGLMYKKV
EMNVCEECGHYLKMTSSERIELSIDPGTWNPMDEDMVSADPIKFHSREEPYKKRIASAQK
KTGLTDAIQTGTGQLNGIPVALGVMDFQFMGGSMGSVVGEKITRLIEYATNQCLPLILVC
SSGGARMQEGSLSLMQMAKISSVLCDYQSSKKLFYISILTSPTTGGVTASFGMLGDIIIA
EPYAYIAFAGKRVIEQTLKKAVPEGSQAAESLLRKGLLDAIVPRNPLKGVVSELFQLHAF
FPLNKNEIK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcgtggttcaatttgatgttttctaagggagaattggaatacagaggcgag
ctaagtaaagcaatggatagttttgctcctattgaaaagactactataagtaaagaccgg
tttatatatgatatggataaaaacttttatggttggggtgagcgttctagttattacaat
aatgttgatcttttagttaactccaaggacattcggaatttcatatcggatgacaccttt
tttgttagggatagtaataaaaatagttattctatatattttgatataaaaaagaaaaaa
tttgagattaacaatgatttgagtgacctagaaatttttttttatagttattgtagttct
agttatctgaataatagatctaaaggtgacaacgatctgcactatgatccttacattaag
gatactaaatataattgtaataatcacattaatagttgcattgactcttattttcgttct
cacatctgtattaatagtcactttttaagcgatagtaataattccaatgaaagttacatt
tataatttcatttgtagtgaaagtggaagtggaaagattcgtgaaagcaaaaatgacaag
ataagaactaatagtaatcgtaataatttaatgagttctaaggatttcgatataactaaa
aactacaatcaattgtggattcaatgcgacaattgttatggattaatgtataagaaagtc
gaaatgaatgtttgtgaagaatgtggacattatttgaaaatgaccagttcagagagaatt
gagctttcgattgatccgggtacttggaatcctatggatgaagacatggtctctgcggat
cccattaaatttcattcgagggaggaaccttataaaaagcgtattgcctctgctcaaaaa
aagacagggttgactgacgctattcaaacaggtacaggtcaattaaacggtattccggta
gctcttggggttatggattttcagtttatggggggtagtatgggatccgtagtaggcgaa
aaaataactcgtttgatcgagtatgctaccaatcaatgtttacctcttattttagtgtgt
tcttccggaggagcacgaatgcaagaaggaagtttaagtttgatgcaaatggctaaaatt
tcttcggttttatgtgattatcaatcaagtaaaaagttattctatatatcaattcttaca
tctcctactaccggtggggtgacagcaagttttggtatgttgggggatatcattattgcc
gaaccctatgcctatattgcatttgcgggtaaaagagtaattgaacaaacattgaaaaaa
gccgtgcctgaaggttcacaagcagctgaatctttattacgtaagggcttattggatgca
attgtaccacgtaatcctttaaaaggtgttgtgagtgagttatttcagctccatgctttt
tttcctttgaacaaaaatgaaatcaaataa

DBGET integrated database retrieval system