KEGG   Brassica napus (rape): 106346558Help
Entry
106346558         CDS       T04128                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00860  Porphyrin and chlorophyll metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106346558
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     106346558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_11 MTS PrmA Methyltransf_18 CMAS Ubie_methyltran TehB Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 106346558
NCBI-ProteinID: XP_013641383
AA seq 313 aa AA seqDB search
MTIAPSLLSSSSSASQFLPRFPTAARFNVAASRSRAVTVVAASVTDLSSVDSTTIAVLGG
GSVAALATIVSLTDPERRRKLQAEEVGGGDKEVVREYFNSTGFERWRKIYGETDEVNRVQ
KDIRIGHAKTVEKTMLMLTEEGSLAGVTVCDAGCGTGLLSIPLAKEGAIVSASDISAAMV
AEAEMKAKQQLASENLPRFEVNDLESLSGKYNTVVCLDVLIHYPQSKADGMIAHLASLAE
KRVILSFAPKTFYYDILKRIGELFPGPSKATRAYLHSEADVENALRKVGWRISKRGLITT
QFYFSRLIEAAPM
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgctccttccttgttgtcatcatcttcctcagcctctcaattcctccctaga
ttcccaaccgccgctaggttcaatgtagccgcttcacggagcagagccgtcaccgtcgtc
gctgcatccgtcaccgacctatccagcgttgacagcacgaccatcgccgtactcggaggc
ggatcagtcgcagctctggcgacgatcgtttccttgacggacccggagaggaggcggaaa
ctgcaggcggaggaagtcggaggaggcgacaaggaggtggtgagggagtatttcaacagc
acggggttcgagcggtggaggaagatctacggcgagactgacgaagtgaaccgcgttcag
aaggatatacgaatcggccacgccaaaacggttgagaaaacgatgctcatgctgacggaa
gaaggttcgttagccggcgtaacggtctgcgacgctggctgcggaacaggtctgctctcg
attccacttgctaaggaaggtgcgatcgtctccgctagcgatatctctgcagctatggtc
gccgaagctgagatgaaggcaaagcagcagttagcatcagagaatctgccgagatttgaa
gtgaatgatttagagagcctaagtgggaagtataacacagttgtatgcctagacgtgctt
atacattaccctcagagcaaagcagacggtatgatcgcacacctggcttcgttagctgag
aagagagtgattctgagttttgcaccaaagacgttctattacgatatcttgaagaggatt
ggagagcttttcccaggtccttcaaaggctacaagggcttatctacactcagaggcggat
gttgaaaatgctttgcgtaaggtcgggtggagaatcagcaagagaggactcattaccacc
cagttctacttctctaggcttatcgaagcagctccaatgtag

DBGET integrated database retrieval system