KEGG   Brassica napus (rape): 106346836Help
Entry
106346836         CDS       T04128                                 

Definition
(RefSeq) putative GDP-L-fucose synthase 2 isoform X1
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106346836
   00520 Amino sugar and nucleotide sugar metabolism
    106346836
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106346836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 CofC 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 106346836
NCBI-ProteinID: XP_013641734
AA seq 328 aa AA seqDB search
MADTTGSDMKPDSFMSEKSAKIFVAGHRGLVGSAIVRKLQESGFTNLILRTHSDLDLTNQ
ADVETFFSTEKPAYVILAAAKVGGIHANNTYPADFIAVNLQIQTNVIHSAYTNGVKKLLF
LGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRIQHQWDAISGMPT
NLYGPNDNFHPENSHVLPALMRRFHEAKVNNAEEVVVWGSGSPLREFLHVDDLADACVFL
MEKYSGFEHVNVGSGVEVTIKELAELVKEVVGFEGKLVWDCTKPDGTPRKLMDSSKLASL
GWTPKVSIRDGLRQTYDWYLENVVQKQQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccacaggatccgacatgaaaccagattcgtttatgtcggagaaatccgca
aaaatcttcgtcgctggacacagaggacttgtcggatccgcaattgtccgaaaactccaa
gaatccggtttcaccaatctcatcctccgaacacattccgacctcgacctcactaaccaa
gccgacgtcgaaaccttcttctccacagagaagcctgcttacgtcatcctcgccgccgcc
aaagtcggtgggatccacgccaacaacacctacccagccgacttcatcgccgtcaatctc
caaatccaaaccaacgtgatccactccgcttacactaacggcgtcaagaaactcctcttc
ctcggctcctcctgcatctaccccaagttcgctcctcagcccataccagaatccgctctc
ctcaccggcccactcgagcccaccaacgagtggtacgccatcgccaagatcgcggggatc
aagatgtgccaagcgtacaggatccagcatcagtgggacgctatctccggcatgccgacc
aacctctacggtccgaacgataatttccaccctgagaattctcatgtgctgcccgctctg
atgaggaggtttcacgaagctaaggttaataatgctgaggaagttgtggtgtggggaagt
gggagtccgttgagggagtttttgcacgttgatgatttggctgatgcttgtgtgttcttg
atggagaagtacagtgggtttgagcatgtgaatgtggggagtggtgtggaagttacgatc
aaggagttggctgagttggttaaggaggttgttgggtttgaagggaagcttgtttgggat
tgtactaagcctgacgggacgccgaggaagctgatggatagctcgaagctcgcgtctttg
ggatggacgccgaaggtttctattagagatggtttgcgccagacttatgattggtatttg
gagaatgttgtgcagaagcagcagtaa

KEGG   Brassica napus (rape): 106354260Help
Entry
106354260         CDS       T04128                                 

Definition
(RefSeq) GDP-L-fucose synthase 1
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106354260
   00520 Amino sugar and nucleotide sugar metabolism
    106354260
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106354260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 106354260
NCBI-ProteinID: XP_013649610
AA seq 322 aa AA seqDB search
MAETIGSEMSDKSAKIFVAGHSGLVGSAIVRKLQQLGYTNLLLRTHAELDLTRQADVESF
FAQEKPVHVILAAAKVGGIHANNTYPADFIAVNLQIQTNVIHSAYLHGVKKLLFLGSSCI
YPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKTCQAYRIQHNWDAISGMPTNLYGPS
DNFHPQNSHVLPALMRRFHEAKVSGAEEVVVWGSGSPLREFLHVDDLADACVFLLENYSG
LEHVNIGSGQEVTIKELAELVKEVVGFEGKLGWDSTKPDGTPRKLMDSSKLASLGWTPKV
SLRDGLRQTYEWYLENVCADKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgatcggctcagagatgtctgacaaatcggccaaaatcttcgtcgctggc
cacagcggcctagtcggatccgccatcgtccgcaagctccagcaattaggttacacgaac
ctcctcctccgaacacacgccgagctcgatctcactcgccaagccgacgtcgaatccttc
ttcgcacaagagaagccagtccacgtcatcctcgccgccgccaaggtcggtgggatccac
gccaacaacacctaccccgccgacttcatcgccgtcaatctccagatccaaaccaacgtg
atccactccgcttacctccacggcgtcaagaagctcctcttcctcggatcctcctgcatc
taccccaagttcgctcctcagcccatccccgagtccgctttgctaaccggaccgctcgaa
ccgaccaacgagtggtacgcgatcgccaagatcgcggggatcaagacctgccaggcgtac
aggatccagcataactgggacgcgatctcggggatgccgacgaatctctacggacctagc
gataattttcatcctcagaactcgcacgtgttgcctgcgcttatgaggaggtttcacgag
gcgaaggtgagtggagctgaggaggttgttgtgtgggggagtgggagtccgttgagggag
tttttgcacgtggatgatttggctgatgcttgtgtgttcttgttggagaattacagcggg
ttggagcatgtgaatatagggagtgggcaagaggtgacgattaaggagttggctgagttg
gtgaaagaggttgttgggtttgaagggaagcttgggtgggatagtacgaagcctgatggg
acgccgaggaagctgatggatagctcgaagctcgcgtctttggggtggacgcctaaggtt
tctttgagagatggtcttcgccagacttatgagtggtacttggagaatgtttgtgcagac
aagaagtga

KEGG   Brassica napus (rape): 106355404Help
Entry
106355404         CDS       T04128                                 

Definition
(RefSeq) putative GDP-L-fucose synthase 2
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106355404
   00520 Amino sugar and nucleotide sugar metabolism
    106355404
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106355404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 106355404
NCBI-ProteinID: XP_013650819
AA seq 151 aa AA seqDB search
MPTNLYGPNDNFHPENSHVLPALMRRFHEAKANDAEEVVVWGSGSPLREFLHVDDLAEAC
VFLMERYSGFEHVNMGSGVEVTIKELAELVKEVVGFEGNLVWDCSKLDGTPRKLMDSSKL
AALGWTPKVSIKDGLRQTYQWYLENVVQKKQ
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaatctctacggtccgaacgataatttccaccctgagaactctcatgtgctt
cctgctctgatgaggaggttccatgaagctaaggccaacgatgcggaggaggttgtggtg
tggggaagtgggagcccgttgagggagtttttgcacgtggatgatttggctgaggcttgt
gttttcttgatggagaggtacagtgggtttgagcatgtgaatatggggagtggtgtggaa
gtgacgatcaaagagttggctgagttggttaaggaggttgttgggtttgaagggaatctt
gtttgggattgtagtaagcttgatgggacgccgaggaagctgatggatagctcgaagctt
gcggctttggggtggacgccgaaggtttcgattaaagatgggcttcgtcagacttatcaa
tggtatttggagaatgttgtgcagaagaagcagtga

KEGG   Brassica napus (rape): 106383754Help
Entry
106383754         CDS       T04128                                 

Definition
(RefSeq) putative GDP-L-fucose synthase 2
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106383754
   00520 Amino sugar and nucleotide sugar metabolism
    106383754
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106383754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 106383754
NCBI-ProteinID: XP_013679269
AA seq 151 aa AA seqDB search
MPTNLYGPNDNFHPENSHVLPALMRRFHEAKANDAEEVVVWGSGSPLREFLHVDDLAEAC
VFLMERYSGFEHVNMGSGVEVTIKELAELVKEVVGFEGNLVWDCSKLDGTPRKLMDSSKL
AALGWTPKVSIKDGLRQTYQWYLENVVQKKQ
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaatctctacggtccgaacgataatttccaccctgagaactctcatgtgctt
cctgctctgatgaggaggttccatgaagctaaggccaacgatgcggaggaggttgtggtg
tggggaagtgggagcccgttgagggagtttttgcacgtggatgatttggctgaggcttgt
gttttcttgatggagaggtacagtgggtttgagcatgtgaatatggggagtggtgtggaa
gtgacgatcaaagagttggctgagttggttaaggaggttgttgggtttgaagggaatctt
gtttgggattgtagtaagcttgatgggacgccgaggaagctgatggatagctcgaagctt
gcggctttggggtggacgccgaaggtttcgattaaagatgggcttcgtcagacttatcaa
tggtatttggagaatgttgtgcagaagaagcagtga

KEGG   Brassica napus (rape): 106394904Help
Entry
106394904         CDS       T04128                                 

Definition
(RefSeq) putative GDP-L-fucose synthase 2
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106394904
   00520 Amino sugar and nucleotide sugar metabolism
    106394904
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106394904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 106394904
NCBI-ProteinID: XP_013690904
AA seq 121 aa AA seqDB search
MADATGSGSFMSEKTAKIFVAGHRGLVGSAIVRKLRESGFKNLLLKTHSELDLTNQSDVE
SFFATEKPAYVILGGIHANNTYPADFISVILQIQTSVIHSAYTHGVKKLLFLGSSCQGKR
C
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgccacaggatccggttcgtttatgtcggaaaaaaccgcgaagatctttgtc
gcgggacacagaggattggtcggatccgccattgtccgaaaactccgagaatccggtttc
aaaaacctcctccttaaaacccattccgagcttgacctcactaaccaatccgacgtcgaa
tcattcttcgccacagagaaacctgcttacgtcatcctcggtgggatccacgccaacaac
acgtacccagctgacttcatctccgtcattctccaaatccaaaccagcgtcatccactct
gcctacacgcacggcgtgaagaagcttctcttcctcggctcctcttgccaaggcaaacga
tgctga

KEGG   Brassica napus (rape): 106427171Help
Entry
106427171         CDS       T04128                                 

Definition
(RefSeq) putative GDP-L-fucose synthase 2 isoform X1
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106427171
   00520 Amino sugar and nucleotide sugar metabolism
    106427171
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     106427171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD CofC
Motif
Other DBs
NCBI-GeneID: 106427171
NCBI-ProteinID: XP_013723363
UniProt: A0A078G144
AA seq 328 aa AA seqDB search
MADTTGSDMKPGSFMSEKSAKIFVAGHRGLVGSAIVRKLQESGFTNLILRTHSELDLTNQ
SDVESFFSAEKPAYVILAAAKVGGIHANNTYPADFIAVNLQIQTNVIHSAYTNGVKKLLF
LGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRIQHQWDAISGMPT
NLYGPNDNFHPENSHVLPALMRRFHEAKANNAEEVVVWGSGSPLREFLHVDDLADACVFL
MEKYSGFEHVNVGSGVEVTIKELAELVKEVVGFEGKLVWDCTKPDGTPRKLMDSSKLASL
GWTPKVSIRDGLRQTYDWYLENVVQKKQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccacaggatccgacatgaaaccaggttcgtttatgtcggagaaatccgcg
aagatcttcgtcgctggacacagaggattggtcggatccgccattgtccgaaaactccaa
gaatccggtttcaccaatctcatcctccgaacacattcagagctcgacctcactaaccaa
tccgacgtcgaatcctttttctccgcagagaagcctgcttacgtcatcctcgccgcagcc
aaagtcggtgggatccacgccaacaacacctacccagctgacttcatcgccgtcaatctc
caaatccaaaccaacgtgatccactccgcttacactaacggcgtcaagaaactcctcttc
ctcggctcctcctgcatctaccccaagttcgctcctcagcccatacccgaatccgctctc
ctcaccggcccgctcgagcccaccaacgagtggtacgcgatcgccaagatcgcgggaatc
aagatgtgccaagcgtacaggattcagcatcaatgggatgctatctccggcatgccgacg
aacctctacggtccgaacgataatttccaccctgagaattctcatgtccttcccgctctg
atgaggaggttccacgaagctaaggccaataatgctgaggaagttgtggtgtggggaagt
ggaagcccgttgagggagttcttgcacgtggatgatttggctgatgcttgcgttttcttg
atggagaagtacagtgggtttgagcatgtgaatgtggggagtggtgtggaagtgacgatc
aaagagttggctgagttggttaaagaagttgttgggtttgaagggaagcttgtttgggat
tgtactaaacccgatgggacgccgaggaagctgatggatagctccaagctcgcgtctttg
ggttggaccccgaaggtttctattagagatggtttgcgccagacttatgattggtatttg
gagaatgttgtgcagaagaagcagtaa

KEGG   Brassica napus (rape): 111199314Help
Entry
111199314         CDS       T04128                                 

Definition
(RefSeq) GDP-L-fucose synthase 1
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111199314
   00520 Amino sugar and nucleotide sugar metabolism
    111199314
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     111199314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 111199314
NCBI-ProteinID: XP_022544909
AA seq 322 aa AA seqDB search
MAETIGSEMSDKSAKIFVAGHRGLVGSAIVRKLHQLGYTNLLLRTHAELDLTRQADVESF
FAQEKPVHVILAAAKVGGIHANNTYPADFIAVNLQIQTNVIHSAYLHGVKKLLFLGSSCI
YPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKTCQAYRIQYKWDAISGMPTNLYGPN
DNFHPQNSHVLPALMRRFHEAKVSGAEEVVVWGSGSPLREFLHVDDLADACVFLLERYSG
LEHVNIGSGQEVTIKELAELVKEVVGFEGKLGWDSTKPDGTPRKLMDSSKLAALGWTPKV
SLRDGLRQTYEWYLENVCAASK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgatcggctcagagatgtctgacaaatccgccaaaatcttcgtcgctggc
caccgcggcctagtcggatccgccatcgtccgcaagctccatcaactaggctacacaaac
ctcctcctccgaacgcacgccgagctcgatctcacccgccaagccgacgtcgaatccttc
ttcgcacaagagaagccagtccacgtcatcctcgccgcagccaaggtcggcgggatccac
gccaacaacacctaccccgcagacttcatcgccgtcaatctccagatccaaaccaacgtg
atccactccgcttacctccacggcgtcaagaagctcctcttcctcggatcctcctgcatc
taccccaagttcgctccccagcccatccccgaatcggctctcttaaccggcccgctcgaa
ccgaccaacgagtggtacgcgatcgcgaagatcgcggggatcaagacctgccaggcgtat
aggatacaatacaaatgggacgcgatctcggggatgccgacgaatctgtacggacctaac
gataattttcaccctcagaactcgcacgtgttgcctgcgcttatgaggaggtttcacgag
gcgaaagtgagtggagctgaggaggttgtggtgtgggggagtgggagtccgttgagggag
tttttgcacgtggatgatttggctgacgcgtgtgtgttcttgttggagaggtacagtggg
ttggagcatgtgaatatagggagtgggcaagaggtgacgattaaggagttggctgagttg
gttaaagaggttgttgggtttgaagggaagcttgggtgggatagtacgaagcctgatggg
acgccgaggaagctgatggatagctcgaagcttgcggctttggggtggacgccgaaggtt
tctttgagagatgggcttcgccagacttatgagtggtatttggagaatgtttgtgcagcc
agtaagtga

DBGET integrated database retrieval system