KEGG   Brassica napus (rape): 106346856Help
Entry
106346856         CDS       T04128                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106346856
   00650 Butanoate metabolism
    106346856
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     106346856
    1.1.1.-  
     106346856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 ApbA 2-Hacid_dh_C F420_oxidored Shikimate_DH 3HCDH_N Sacchrp_dh_NADP NAD_Gly3P_dh_N TM2
Motif
Other DBs
NCBI-GeneID: 106346856
NCBI-ProteinID: XP_013641761
AA seq 343 aa AA seqDB search
MALCSIFCPRIPVRFRPKPISPFLSKPLFPLSYRVYSSLPPTSSTKDELGSVSIGFLGMG
IMGSPMAQNLLKAGCDVTVWNRTKSKCDPLVGLGAKYKSSPEEVTATCDLTFAMLADPES
AIDVACGKNGAVSGISSGKGYVDVSTVDAASSILISKQIKDTGALFLEAPVSGSKKPAED
GQLIFLTAGDKLLYEKAAPFLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMASFAEGIL
LSQKVGLDPNVLVEVVSQGAINAPMYSLKGPSMIKSVYPTAFPLKHQQKDMRLALGLAES
VSQSTPIAAAANELYKVAKSYGLSDEDFSAVMEALKAARSQQS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtgctccatcttctgccctcgcatccctgttcgattcagacccaaacccatt
tctcctttcctctcaaagcctttgtttcccctctcttatagggtttactcttccctgcca
cctacttcctctaccaaagatgaacttggaagtgtaagcattgggtttctgggtatggga
atcatgggttctcctatggcacaaaacctcctcaaagctgggtgtgatgtgactgtgtgg
aatcgaactaagagcaaatgtgatcctctcgtcggtttaggagcaaaatacaagtcttct
cctgaagaagtgactgcaacttgtgatctcacatttgcaatgctagcagatcctgaaagt
gcaatcgatgttgcctgtggaaagaatggagccgtatctggaattagctcaggaaaaggg
tatgttgatgtctcaaccgttgatgctgcctcatccatcttaatcagcaagcaaataaag
gatactggagcactgtttttagaggcaccagtttctggttccaaaaagcctgcagaagat
ggtcagctgatattcctcactgcaggtgacaagctactctacgaaaaagctgcacctttc
ttagacatcatgggaaagtcaagattctacttgggtgatgttggtaatggagcagcaatg
aaacttgtcgtcaacatgatcatgggaagtatgatggcatcattcgccgagggaatactc
ctaagccagaaagtaggacttgatccaaatgtacttgtcgaagttgtttcacaaggagct
atcaatgcgccaatgtactcactcaagggtccttcaatgatcaagtcagtgtaccctaca
gcttttccattgaagcaccagcagaaggatatgagacttgcactgggactagctgagtct
gtgtctcagtcaaccccaattgcagcagcagcaaacgagctttacaaagttgccaagtca
tacggtttgagcgatgaagacttctctgcggttatggaagcactgaaagctgcaagatct
caacaaagctaa

KEGG   Brassica napus (rape): 106367684Help
Entry
106367684         CDS       T04128                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 1 isoform X1
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106367684
   00650 Butanoate metabolism
    106367684
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     106367684
    1.1.1.-  
     106367684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 ApbA F420_oxidored Shikimate_DH Sacchrp_dh_NADP 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN GPCR_chapero_1
Motif
Other DBs
NCBI-GeneID: 106367684
NCBI-ProteinID: XP_013662969
AA seq 289 aa AA seqDB search
MEIGFLGLGIMGKAMAMNLLKHGFKVTVWNRTLSKCDELVEHGASMGETPAQVIKKCKYT
IAMLSDPCAALSVVFDKDGVLEQICEGKGYIDMSTVDAETSLKINQAITGKGGRFVEGPV
SGSKKPAEDGQLIILAAGDKSLFDETVPAFDVLGKKSFYLGQVGNGAKMKLVVNMVMGSM
MNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDM
RLALALGDENAVSMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSRE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagattggttttctgggcttgggtatcatgggaaaggccatggcaatgaatctgttg
aaacatggattcaaagttaccgtctggaacaggacactctccaagtgtgatgaacttgtg
gagcatggagcttcaatgggtgagactccagctcaagtaatcaagaaatgcaaatacact
atcgctatgctatctgacccttgtgctgctctctcggttgttttcgataaagatggtgtt
ttagagcaaatctgtgaaggaaaagggtatatcgatatgtcaacagttgatgcagagact
tccttaaagatcaaccaggcaatcactgggaaaggcggtcggtttgtagaaggtcctgtt
tcaggtagcaagaagccggcagaagatggccagctcatcatacttgctgctggtgacaag
tcccttttcgatgaaacggtcccagcttttgacgtattggggaagaagtctttttacttg
ggacaagtcgggaacggagctaagatgaaacttgtagtcaacatggtcatgggaagcatg
atgaacgcgttttctgaggggcttgtattagctgacaagagtggacttagctctgacact
cttcttgatattctggatcttggtgcaatgacaaacccgatgttcaaagggaaaggacct
tcgatgaataagagtagttacccacctgcgttcccgttgaaacatcagcagaaggacatg
aggctagctcttgctcttggcgatgaaaacgctgtctccatgcctgtagctgcagctgca
aatgaggcttttaagaaggcgagaagcatgggacttggagatctggacttctctgctgtg
attgaggctgtgaaattctccagggaatag

KEGG   Brassica napus (rape): 106430323Help
Entry
106430323         CDS       T04128                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 1-like
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106430323
   00650 Butanoate metabolism
    106430323
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     106430323
    1.1.1.-  
     106430323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 ApbA F420_oxidored Shikimate_DH Sacchrp_dh_NADP 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-GeneID: 106430323
NCBI-ProteinID: XP_013726567
AA seq 290 aa AA seqDB search
MEIGFLGLGIMGKAMAMNLLKHGFKVTVWNRTLSKCDELVEHGASMGETPAQVIKKCKYT
ISMLSDPCAALSVVFDKDGVLEQICEGKGYIDMSTVDAETSLKINQAITGKGGRFVEGPV
SGSKKPAEDGQLIILAAGDKSLFDETVPAFDVLGKKSFYLGQVGNGAKMKLVVNMVMGSM
MNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDM
RLALALGDENAVSMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSREQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagattgggtttctgggcttgggtatcatgggaaaggccatggcaatgaatctgttg
aaacatggattcaaagttaccgtctggaacaggacactctccaagtgtgatgaacttgtg
gagcatggagcttcaatgggtgagactccagctcaagtaatcaagaaatgcaaatacact
atctctatgctctctgacccttgtgctgctctctcggttgttttcgataaagatggtgtt
ttagagcaaatctgtgaaggaaaagggtatatcgatatgtcaacagttgatgcagagact
tccttaaagatcaaccaggcaatcactgggaaaggcggtcggtttgtagaaggtcctgtt
tcaggtagcaagaagccggcagaagatggccagctcatcatacttgctgctggtgacaag
tcccttttcgatgaaacggtcccagcttttgacgtcttggggaagaagtctttttacttg
ggacaagtcgggaacggagctaagatgaaacttgtagtcaacatggtcatgggaagcatg
atgaacgcgttttctgaggggcttgtattagctgacaagagtggacttagctctgacact
cttcttgatattctggatcttggtgcaatgacaaacccgatgttcaaagggaaaggacct
tcgatgaataagagtagttacccaccagcattcccgttgaaacatcagcagaaggacatg
aggcttgctcttgctcttggtgatgaaaacgccgtctccatgcctgtagctgcggctgca
aatgaggcttttaagaaggcgagaagcatgggacttggagatctggacttctctgctgtg
attgaggctgtgaaattctccagggaacagtag

KEGG   Brassica napus (rape): 106447268Help
Entry
106447268         CDS       T04128                                 

Definition
(RefSeq) glyoxylate/succinic semialdehyde reductase 2, chloroplastic
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106447268
   00650 Butanoate metabolism
    106447268
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     106447268
    1.1.1.-  
     106447268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 ApbA 2-Hacid_dh_C F420_oxidored Shikimate_DH 3HCDH_N Sacchrp_dh_NADP NAD_Gly3P_dh_N TM2 SAPIS-gp6
Motif
Other DBs
NCBI-GeneID: 106447268
NCBI-ProteinID: XP_013744615
UniProt: A0A078IG19
AA seq 343 aa AA seqDB search
MAFCSIFCPRIPVRFRPKPISPFLSKPLFPLSYRVYSSLQPTPSTKDELGSVSIGFLGMG
IMGSPMAQNLLKAGCDVTVWNRTKSKCDPLVGLGAKYKSSPEEVTATCDLTFAMLADPES
AIDVACGKNGAVSGISSGKGYVDVSTVDAASSILISKQIKDTGALFLEAPVSGSKKPAED
GQLIFLTAGDKLLYEKAAPFLDIMGKSRFYLGDVGNGAAMKLVVNMIMGSMMASFAEGIL
LSQKVGLDPNVLVEVVSQGAINAPMYSLKGPSMIKSVYPTAFPLKHQQKDMRLALGLAES
VSQSTPIAAAANELYKVAKSYGLSDEDFSAVIEALKAARSQQS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctttttgctcgatcttctgccctcgtatccctgttcgattcagacccaaacccatt
tctcctttcctctcaaagcctttgtttcccctctcttatagagtttactcttccctgcaa
cctactccctctaccaaagatgaacttggaagtgtaagcattgggtttctgggtatggga
atcatgggttctcctatggcacaaaacctcctcaaagctgggtgtgatgtgactgtgtgg
aatcgaactaagagcaaatgtgatcctctcgtcggtttaggagcaaaatacaagtcttct
cctgaagaagtgactgcaacttgcgatctcacatttgcaatgctagcagatcctgaaagt
gcaatcgatgttgcctgtggaaagaatggagccgtatctggaattagctcaggaaaaggg
tatgttgatgtctcaaccgttgatgctgcctcatccatcttaatcagcaagcaaataaag
gacaccggagcattgtttttggaggcaccagtttctggttccaaaaagcctgcagaagat
ggtcagctgatattcctcactgcaggtgacaaactactctacgaaaaagctgcacctttc
ttagacatcatgggaaagtcaagattctatttgggagatgttggtaatggagcagcaatg
aaacttgtcgtcaacatgatcatgggaagtatgatggcatcatttgccgagggaatactt
ctaagccagaaagtaggacttgatccaaatgtactagtcgaggttgtttcacagggagct
atcaatgcgccaatgtactcgcttaaaggtccttcaatgatcaagtcagtgtaccctacg
gcttttccattgaagcaccagcagaaggatatgagactcgcactgggactagctgagtcc
gtgtctcagtctactccaattgcagcagcagcaaacgagctttacaaagttgccaagtct
tacggtttgagcgatgaagacttctctgcggttattgaagcactgaaagctgcaagatct
caacaaagctaa

DBGET integrated database retrieval system