KEGG   Brassica napus (rape): 106347295Help
Entry
106347295         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106347295
   00030 Pentose phosphate pathway
    106347295
   00051 Fructose and mannose metabolism
    106347295
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106347295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106347295
NCBI-ProteinID: XP_013642264
UniProt: A0A078JHX5
AA seq 619 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVEFGDGTTVAEASDSHIVARAFPHT
LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNANST
LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV
NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVSNLKSPVNKWKCG
AAPITAMMTVKNWSQNASSTSTSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSSSNGGQQFA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggattcagatttcggaatcccaagagagctctctcctcttcagcaactccgttctcag
taccaccccgagcttcctccttgtctccagggaactactgtgcgcgtggagtttggtgat
ggaaccactgtggctgaggcttctgattcccatatcgttgctcgtgccttccctcatacc
ttaggccagcctttggctcacttcctcagggaagctgccaaagtttccgatgctcacatc
attactcagcttccttctatcagagttggaatcgtgttttgtggaaggcaagctcctggt
ggacacaatgtaatctggggtctttacgaggctctcaaggtgcacaacgcaaacagcaca
ttgcttggctttttgggtggctcggaaggtctgtttgctcaaaagactctggagatcact
gatgatatactccagacttacaaaaaccaaggtggctatgatttgctgggaagaaccaag
gatcagatcagaaccactgagcaggttaacgctgctctcaaagcttgcacagatttgaag
ctagatggccttgttatcattggaggtgtaacatcaaacacagatgccgctcatcttgct
gaatttttcgctgaagcaaaatgctcaacaaaggtagttggtgttccagtcactacaaat
ggagatctcaagaatcagtttgtggaggcaaacgttggttttgacaccatatgcaaggtg
aattctcagctcattagcaatgcctgcaccgatgctctatctgcagagaagtactattat
tttatccgtctcatgggtcggaagcactctcatgttgcccttgagtgtaccctccagtct
catccaaacatggtgatactgggagaggaggtcgcagcatctaagctcaccatttttgac
atttctaagcagatctgtgatgcagttcaagcaagagcaggacaagacaagaatcatgga
gtcatcctcattcccgaagggatcatagagagtattcctgaagtttacgctctgttgaag
gaaattcatgggctacttagggagggtgtagctgctgataagatatctactcagctctca
ccttggtcatctgctttgtttgaattccttcctccattcattaagaaacagctactcctc
catcctgagtctgatgattctgctcagctatcccaaattgagactgagaagcttctcgcg
tatctggtggagactgaaatgaacaagcgcttgaaagaaggcacatacaaggggaagaag
ttcaatgctatatgtcacttctttggttaccaagctcgtggatctctcccatcgaagttc
gattgtgattatgcatacgtgcttggacatatatgttaccacatcctagcagctggtttg
aatggttacatggcaacagtgagcaacctaaaaagtcctgtaaacaagtggaaatgtggt
gctgcacctattacagcgatgatgacggtgaagaactggtcccaaaatgctagttctact
tcaacttcaattggtagacctgcaattcacccggcaatggtggatctgaaaggcaaagca
tacgagctgttgagacagaacgcagataaattcttgatggaagatctgtacagaaaccca
ggaccgcttcagtacgatggtccaggtgcagatgctaaagcagtgagtctctgcgttgaa
gatcaagactacatgggacggatcaagaagctccaggaatatctagaccaggtgaggaca
atagtgaagccaggatgttcacaagacgtactgaaagcagcactgagcgtgatggcttca
gtgactgatgtccttactaccatttcttcatcttcaaatggtggtcaacagttcgcttaa

KEGG   Brassica napus (rape): 106363198Help
Entry
106363198         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1-like
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106363198
   00030 Pentose phosphate pathway
    106363198
   00051 Fructose and mannose metabolism
    106363198
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106363198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106363198
NCBI-ProteinID: XP_013658441
AA seq 379 aa AA seqDB search
MQNLARTVYYLRIIWEQYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVSNLKSPVNKWKCG
AAPITAMMTVKNWSQNASSTSTSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSSSNGGQQFA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacttagctagaaccgtgtattacttaagaattatttgggagcagtactattac
ttcatccgtcttatgggtcgaaagcactctcatgttgcccttgagtgtaccctccagtct
catccaaacatggtgatactgggagaggaggtcgcagcatctaagctcaccatttttgac
atttctaagcagatctgtgatgcagttcaagcaagagcaggacaagacaagaatcatgga
gtcatcctcattcccgaagggatcatagagagtatccctgaagtctacgctctgctaaag
gaaattcatgggctacttagggagggtgtagctgctgataagatatctactcagctctca
ccttggtcatctgctttgtttgaattccttcctccattcattaagaaacagctactcctc
catcctgagtctgatgattctgctcagctatcccaaattgagacggagaagcttctggcg
tatctcgtggagactgaaatgaacaagcgcttgaaagaaggcacatacaagggcaagaag
ttcaatgctatatgtcacttctttggttaccaagctcgtggatctctcccatcgaagttc
gattgtgattatgcatacgtgcttggacatatatgttaccacatcctagcagctggtttg
aatggttacatggcaacagtgagcaacctaaaaagtcctgtaaacaagtggaaatgtggt
gctgcacctattacagcgatgatgacggtgaagaactggtcccaaaatgctagttctact
tcaacttcaattggtagacctgcaattcacccggcaatggtggatctgaaaggcaaagca
tacgagctgttgagacagaacgcagataaattcttgatggaagatctgtacagaaaccca
ggaccgcttcagtacgatggtccaggtgcagatgctaaagcagtgagtctctgcgttgaa
gatcaagactacatgggacggatcaagaagctccaggaatatctagaccaggtgaggaca
atagtgaagccaggatgttcacaagacgtactgaaagcagcactgagcgtgatggcttca
gtgactgatgtccttactaccatttcttcatcttcaaatggtggtcaacagttcgcttaa

KEGG   Brassica napus (rape): 106366128Help
Entry
106366128         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106366128
   00030 Pentose phosphate pathway
    106366128
   00051 Fructose and mannose metabolism
    106366128
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106366128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106366128
NCBI-ProteinID: XP_013661141
AA seq 568 aa AA seqDB search
MASPYDLTGENIAGISINPPASRVPSVYSEVQVSRIDHALPLPSAFKSPFKIVDGPPSSA
AGNSEEIAKLFPNLYGQPSALLVSDQSNDAVLSDQKLKVGVVLSGGQAPGGHNVICGIFD
YLQEHAKGSTLFGFRGGPAGIMKGKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFK
QAEDTVTKMDLDGLVVIGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKSKEVPT
SFGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEE
VSEKKLTLKNVTDYIVDVICKRAENGYNYGVILVPEGLIDFIPEVQELISELNEILAQGN
VDEEGQWKKNLKEETLKLFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQMVETELE
KKKKDGSYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGLISSVGN
LAAPVEKWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEWALKNRY
ISPGPIQFKGPGSDAINHTLLLELGAQA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaccgtatgacttaactggagaaaacatcgccgggatctcgatcaatcctcct
gcgagccgtgtgccttctgtttacagtgaagtccaagtgagtcgtatcgatcacgcgctc
cctcttccttccgcttttaaaagtccctttaagatcgtcgatggtcctccgagctccgcc
gctggaaattcagaggagattgcgaaattatttccaaatctgtatggacaaccatcggct
ttattggtttcagaccaatctaatgatgcagttctgtcggaccaaaagcttaaagttggt
gtggttttgtctggtggacaagcacctggaggacacaatgttatttgcggaattttcgat
tatttacaggaacatgcgaaagggagcacactgtttggttttcgtggtggtccagctgga
atcatgaaagggaaatatgttgagctcacttctgattttgtgtatccatatagaaaccag
ggtgggtttgatatgatatgcagtggaagagacaagatcgaaactccagagcagtttaag
caagctgaagatactgtaacaaagatggacttagatggtctggtggttattggtggcgat
gactccaatactaatgcttgtctcctcgctgaatacttcagaggtaaaaacatgaaaact
agggttattgggtgtcccaaaacaatcgatggtgatttaaagagcaaagaagtccccacc
agtttcgggtttgatactgcttgcaagatatactcggaaatgattggaaatgttatgatc
gatgcacgttccactggaaaatactaccactttgtacgtctcatgggccgtgctgcttct
catattacacttgaatgcgctttgcaaacccatccaaacattaccattattggtgaagag
gtttcggagaagaagctaacgttgaaaaacgttacggattacattgttgatgtgatctgt
aaacgcgctgaaaatggttataactacggtgtcattcttgttcctgaaggtctaattgac
tttatccctgaggtccaagagcttatttcagaactgaacgaaatcttagcccaaggaaac
gtcgatgaagaaggacaatggaagaagaatcttaaagaggagactctaaagctttttgag
tttcttcctcaaacaattcaggaacaactgatgcttgagagagatccacatgggaatgtc
caggtggctaaaatagagacagagaaaatgctgattcaaatggttgaaacagagttagag
aaaaagaagaaggatggttcatataaacgcgagttcatggggaaatcacacttctttggg
tatgagggaagatgtggactccctacaaatttcgatgcaacttattgttacgcattgggt
tatggtgctggatcacttctccagagtgggaagactggattgatttcatcggttgggaac
ttggctgctcctgttgagaaatggacagttggtggtacaccgttaacttcattgatggat
gttgagagaagacatggtaaattcaagcctgttatcaagaaagctatggttgagcttgaa
ggcgcaccgtttaagaaatttgcgtcacagcgtgaagaatgggctttgaagaatagatac
attagtcctggtccgattcagtttaagggaccgggatctgatgccataaatcacacttta
ctgcttgaactcggtgctcaagcctga

KEGG   Brassica napus (rape): 106366908Help
Entry
106366908         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2-like
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106366908
   00030 Pentose phosphate pathway
    106366908
   00051 Fructose and mannose metabolism
    106366908
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106366908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106366908
NCBI-ProteinID: XP_013662043
AA seq 568 aa AA seqDB search
MASPYDLTGEDIAGISINPPASRVPSVYSEVQVSRIDHALPLPSVFKSPFTIVDGAPSSA
AGNSEEIAKLFPNLYGQPSALLVSDQSNDAVLSDQKLKVGVVLSGGQAPGGHNVICGIFD
YLQEHAKGSTMFGFRGGPAGIMKGKYVEVTSDFVYPYRNQGGFDMICSGRDKIETPEQFK
QAEDTVTKMDLDGLVVIGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKSKEVPT
SFGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEE
VSEKKLTLKNVTDYIVDVICKRAENGYNYGVILVPEGLIDFIPEVQELISELNEILAQGN
VDEEGQWKKNLKEETLKLFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQMVETELE
KKKKDGSYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGLISSVGN
LAAPVEKWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEWALKNRY
ISPGPIQFKGPGSDTINHTLLLELGAQA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaccgtatgacttaactggagaagacatcgccgggatctcgatcaatcctcct
gcgagccgtgtgccttctgtttacagtgaagtccaagtgagtcgtatcgatcacgcgctt
cctcttccttccgtttttaaaagtccctttacgatcgtcgatggtgctccgagctccgcc
gccggaaattcagaggagattgcgaaattatttccaaatctgtatggacaaccatcggct
ttattggtttcagaccaatctaatgatgcagttctgtcggaccaaaagcttaaagttggt
gtggttttgtctggtggacaagcacctggaggacacaatgttatttgcggaattttcgat
tacttacaggaacatgcgaaaggaagtacaatgtttggttttcgtggtggtccagctgga
atcatgaaaggaaaatatgttgaggtcacttctgattttgtgtatccttatagaaaccag
ggtgggttcgatatgatatgcagtggaagagacaagatcgaaactccagagcagtttaag
caagctgaagatactgtaacaaagatggacttagatggtcttgtagttattggtggagat
gactccaatactaatgcttgtctcctcgctgaatacttcagaggtaaaaacatgaaaact
agggttattgggtgtcccaaaacaatcgatggtgatttaaagagcaaagaagtccccacc
agtttcgggtttgatactgcttgcaagatatactcggaaatgattgggaatgttatgatc
gatgcacgttccactggaaaatactaccactttgtacgtctcatgggccgtgctgcttct
catattacacttgaatgcgctttgcaaacccatccaaacattaccattattggtgaagag
gtttcggagaagaagctaacgttgaaaaacgttacggattacattgttgatgtgatctgt
aaacgcgctgaaaatggttataactacggtgtcattcttgttcctgaaggtctaattgac
tttatccctgaggtccaagagcttatttcagaactgaacgaaatcttagcccaaggaaac
gtcgacgaagaaggacaatggaagaagaatcttaaagaagagactctaaagctttttgag
tttcttcctcaaacaattcaggaacaactgatgcttgagagagatccacatgggaatgtc
caggtggctaaaatagagacagagaaaatgctgattcaaatggttgaaacagagttagag
aaaaagaagaaggatggttcatataaacgcgagttcatggggaaatcacacttctttggg
tatgagggaagatgtggactccctacaaatttcgatgcaacttattgttacgcattgggt
tatggtgctggatcacttctccagagtgggaagactggattgatttcatcggttgggaac
ttggctgctcctgttgagaaatggacagttggtggtacaccgctaacttcattgatggat
gttgagagaagacatggtaaattcaagcctgttatcaagaaagctatggttgagcttgaa
ggcgcaccgtttaagaaatttgcgtcacagcgtgaagaatgggctttgaagaatagatac
attagtcctggtccgattcagtttaagggaccgggatctgataccataaatcacacttta
ctgcttgaactcggtgctcaagcctga

KEGG   Brassica napus (rape): 106373279Help
Entry
106373279         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1-like
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106373279
   00030 Pentose phosphate pathway
    106373279
   00051 Fructose and mannose metabolism
    106373279
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106373279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106373279
NCBI-ProteinID: XP_013668930
AA seq 481 aa AA seqDB search
MAPSLAAVNRDLAAASPDNAPAKGRASVYSEVQSSRINNALPLPSVLKGAFKIVEGPASS
AAGNPDEIAKLFPGLYGQPSVSVVPDQSADLSGQKLKIGVVLSGGQAPGGHNVISGLFDY
LQERAKGSTFYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQFKQ
AEETAKKLDLDGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKCKEVPTS
FGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEV
SAQKQTLKNVTDYMVDVICKRAELGYNYGVILIPEGLIDFIPEVQELIAELNEILANEVV
DESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQMVETELEK
RKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGLHFHYLNI
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggccccttcactcgccgccgttaaccgagatctcgccgccgcatctccggacaacgct
ccggcgaaaggacgtgcttccgtctacagcgaagttcagtctagccgcatcaacaacgcc
cttcctttgccttcagtactcaaaggagccttcaaaatcgtcgaaggacccgctagctcc
gccgccgggaacccagatgagattgccaagttgtttcctggtctatatggacagccgtct
gtgtcggttgttccagatcagagtgcagatttatcaggacagaagctgaagattggagtt
gttttgtctggtggtcaggcgcctggtggacacaatgtcatctctggattgttcgattac
ttgcaggagcgtgctaaaggaagcaccttttacgggttcaagggtggtccagctggcatc
atgaagtgcaagtacgttgagttgaatgctgagtacattcttccttacaggaaccagggt
gggtttgacatgatctgcagtggaagagacaagattgaaacgcctgagcagtttaaacaa
gctgaagaaacagcaaagaagctagatttggatggattggtggttatcggtggagatgac
tccaacaccaatgcttgcctccttgctgagaacttcaggagtaagaacttgaaaaccaga
gtcattgggtgccccaagaccattgatggtgatttgaaatgcaaggaggttcccaccagt
tttgggtttgatacagcttgcaagatttactctgaaatgattggcaatgtcatgattgat
gcaaggtcaactggaaagtactatcattttgttagacttatgggccgtgctgcttcccac
atcacgctggagtgtgctttacaaactcacccaaacataaccattattggagaggaggtt
tctgcccagaagcagactttgaagaatgtcacggactacatggttgatgttatctgcaag
cgtgctgaacttggttacaactacggtgttattctgattccagaaggtctgatcgatttc
attcccgaggttcaggagctgatcgcagaactgaatgaaattctggccaacgaggtggtt
gatgaaagtgggctgtggaagaagaagctcaccgaacaatccctgaagctctttgatctt
ctgcctgaagcgattcaggaacagctgatgctcgagagagacccacacggaaatgtccag
gtggccaagattgagactgagaagatgcttattcaaatggttgaaactgagttggagaaa
agaaagcaagctggttcatacaagggacaattcatggggcagtctcatttcttcgggtat
gaaggaagatgcggtttgcctacaaattttgatgcaacctactgttacgcacttggttat
ggcgctggagttctcctcaacagtggaaaaaccggactacatttccactatttaaatatt
aaataa

KEGG   Brassica napus (rape): 106376252Help
Entry
106376252         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1-like
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106376252
   00030 Pentose phosphate pathway
    106376252
   00051 Fructose and mannose metabolism
    106376252
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106376252
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 106376252
NCBI-ProteinID: XP_013671774
AA seq 97 aa AA seqDB search
MSYLLAQVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASL
REEWALKNRYISPGPIQFTGPGSDALSHTLLLELGAQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttattggcgcaggtcgggaacttggctgctccagttgaagaatggactgta
ggtgggactgctctcacagccttgatggatgtcgagaggagacacggcaagttcaagcct
gtgatcaagaaagcaatggtggaacttgaaggtgcgccgtttaagaaattcgcatcgctg
cgtgaggagtgggctttgaagaaccgatacatcagccctggtccaatccaattcactgga
cctggttcggatgctctcagccacactctacttctcgaactcggggctcaataa

KEGG   Brassica napus (rape): 106412333Help
Entry
106412333         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1-like isoform X1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106412333
   00030 Pentose phosphate pathway
    106412333
   00051 Fructose and mannose metabolism
    106412333
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106412333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106412333
NCBI-ProteinID: XP_013708704
AA seq 506 aa AA seqDB search
MIADEIAKLFPGLYGQPSVSVVPDPSAASSGQKLKIGVVLSGGQAPGGHNVISGLFDYLQ
ERAKGSTFYGFKVGPAGIMKFKYVELNAEYIHPYRNQILGGFDMICSGRDKIETPEQFKQ
AEETTNKLDLDGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKCKEVPTS
FGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEV
SAQKQTLKNVTDYMVDVICKRGELGYNYDVILIPEGLIDFIPEVQELIAELFEILANEVV
DESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIEPEKMLIQMVETELEK
RKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGLISSVGNL
AAPVEEWTVGGTALTALMDVERRHGKFKHVIKKAMVELEGAPFKKFASLREEWALKNRYI
SPGPIQFSGPGSDALSHTLLLELGVQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagatgagattgcgaagttgtttcctggtctatatggtcagccatctgtatca
gttgttccagacccgagtgctgcttcgtcgggacagaagctgaagatcggtgttgttctg
tctggaggtcaggctcctggtgggcacaatgtcatctctggattgttcgattacttgcag
gagcgtgccaaaggaagcaccttttacgggttcaaggttggtccagctggtatcatgaaa
ttcaaatatgttgagttgaatgcggaatacattcatccttacagaaaccagatacttggt
ggttttgacatgatctgcagtggaagagacaagattgaaacgcctgagcagtttaaacaa
gctgaagaaacaacaaataagctagatttggatggattggtggttatcggtggagatgac
tccaacaccaatgcttgccttcttgctgaaaacttcaggagtaagaatttgaaaacccga
gtcattgggtgccccaagaccattgatggtgatttgaaatgcaaagaggttcctactagt
tttgggtttgatacagcttgcaagatttactctgaaatgattggaaatgtcatgatcgat
gcaaggtcaactggaaagtactatcactttgtacgacttatgggtcgtgctgcttcccac
attacgcttgagtgtgctttacaaactcacccgaacataaccattattggagaggaggtg
tctgcacagaagcagactttgaagaatgtcacagattacatggtagatgttatctgcaag
cgtggtgaacttggttacaactacgatgttatactgattccagaaggtctgatcgacttt
attcctgaggtccaggagctgatcgcagagctgtttgaaattctggcaaatgaggttgtt
gatgaaagtggactgtggaagaagaagctcaccgaacaatccctgaagctgtttgatctt
ctgcctgaagcgattcaggaacagctgatgctcgagagagacccacacggaaatgtccag
gtggccaaaattgagcctgagaagatgcttattcaaatggttgaaactgaattggagaaa
agaaagcaagctggttcatacaagggacaattcatggggcagtctcatttcttcgggtat
gaaggacgatgcggtttgcctacaaattttgatgccacctactgttatgcacttggttat
ggcgctggagtactcctcaatagtgggaaaaccggtctgatctcttcggtcgggaacttg
gctgcacctgtggaagaatggactgtgggtgggactgctctcacggccttgatggatgtc
gagaggagacacggtaagttcaagcatgtgatcaagaaagcaatggtggagcttgaaggt
gcaccgtttaagaaatttgcatccctgcgcgaggaatgggccttgaagaaccgatacatc
agccctggtccaatccaattctcgggacctggttcagatgctcttagccacactctactt
ctcgaacttggggttcaataa

KEGG   Brassica napus (rape): 106416093Help
Entry
106416093         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1 isoform X1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106416093
   00030 Pentose phosphate pathway
    106416093
   00051 Fructose and mannose metabolism
    106416093
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106416093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106416093
NCBI-ProteinID: XP_013712380
AA seq 619 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT
LGQPLAHFLRETAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST
LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACIDLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV
NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCG
AAPITAMMTVKNWSQNAGSTSTSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSSSNGGQQTA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggattcagacttcggaatccccagagaactctctcctctccagcaactccgttctcag
taccaacctgagcttcctccttgtctccagggaactactgtccgcgtggagcttggtgat
ggaaccactgtgtccgaagcttctgattctcacatcatagctcgtgccttcccacatacc
ttaggacagcctctggctcacttcctcagggaaaccgccaaagtctctgatgctcacatc
attactcagcttccatctatcagagttggaatcgtcttctgtggaaggcaagctcctggt
ggtcacaatgttatctggggtctttacgaggctcttaaggttcacaacgctaaaagcacc
ttgcttggcttcttgggtggttcagaaggtctatttgcgcaaaagactctggagatcaca
gatgatatactccaaacttacaagaaccaaggtggttatgatttactgggaagaaccaag
gatcagatcagaaccactgagcaggtcaacgctgcactcaaagcttgcattgatttgaag
ttagatggccttgttatcattggaggtgtgacatcaaacacagatgctgctcatcttgct
gaatttttcgctgaagcaaaatgctccacaaaggtagttggtgttccggttactacaaat
ggagatctcaagaatcagtttgtggaggcaaacgttggttttgacaccatctgcaaggtg
aattctcagctcattagcaatgcatgcactgatgctctatctgcagagaagtactattat
ttcatccgtctcatgggtcggaagcactctcatgttgcacttgagtgtaccctccagtct
catccaaacatggtgatactgggagaggaggttgcagcatctaagctcaccatatttgac
atctctaaacagatctgtgatgcagttcaagcaagagcaggacaagacaagaatcatgga
gtcatcctcattcccgaagggatcatagagagcattcctgaagtctacgctctgttaaag
gaaattcacgggctacttagggagggtgtagctgctgataagatatctactcagctctct
ccttggtcatctgctttgtttgaattcctccctccattcattaagaaacagctacttctc
catcctgagtctgatgattctgctcagctatcccagattgagacggagaagcttcttgcg
tatctcgtggagactgaaatgaacaagcgcttaaaagaaggcacatacaagggaaagaag
ttcaatgctatatgtcacttctttggttaccaagctcgtggatctctcccatccaaattc
gactgtgattatgcctacgttcttgggcatatatgttaccacatcctcgcagctggtctg
aatggttacatggcaacagtgaccaacctaaagagtcctgtaaacaagtggaaatgtggt
gctgcacctattacagcaatgatgacggtgaagaactggtcccaaaatgctggttctact
tcaacttcaattggtagacctgcaattcatccggcaatggtggatctgaaaggcaaagca
tacgagcttttgagacagaacgcagacaaattcttgatggaagatctgtacaggaaccca
gggccgcttcagtacgatggtcctggcgcagatgctaaagcagtgagtctctgcgttgaa
gatcaagattacatggggcgtatcaagaagctgcaagaatatctagaccaggtgaggacg
atagtgaagccagggtgttctcaagacgtattgaaagcagcactgagcgtgatggcttca
gtgaccgatgttctcaccaccatttcttcatcttcaaatggtggtcaacaaactgcttag

KEGG   Brassica napus (rape): 106421674Help
Entry
106421674         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 2
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106421674
   00030 Pentose phosphate pathway
    106421674
   00051 Fructose and mannose metabolism
    106421674
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106421674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106421674
NCBI-ProteinID: XP_013717969
AA seq 617 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT
LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT
LLGFLGGSEGLFAQKTVEITDEVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTYLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICKV
NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD
ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADNISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRTKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGRICYHILAAGLNGYMATVTNLKSPVNKWKCG
AAPMTAMMTVKRWSQNSGSTSIGRPAIHPATVDLKGKAYELLRQNAQKFLMEDMYRNPGP
VQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTLVKPGCSQDVLKAALSVMASVT
DVLSTISSSSTSGQQFA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggattcagattttggaatccctagagaactctctcctcttcaacagcttcgatctcag
taccagcctcagctccctccttgtctccaggggagaactgttcgcgttgaatttggtgat
ggaaccactgtggctaaatctggtgactctcatatcattgcgcgtgccttcccgcatact
ctaggccagcctttggctcacttccttagggcgactgccaaagttcctgatgctcagatc
atcaccgagcatccagccattagggttggaattgtgttttctggaaggcaggctcctggt
ggtcacaatgtaatttggggtctttatgaggctctcaaagtgcataacgcaaagaacact
ctgctaggatttttgggtggttctgaaggtctatttgcccaaaagaccgtggagatcact
gatgaagtcctccaaacctacaaaaaccaaggtggctttgatttgcttggaagaacaaag
gatcagattagaacaaccgagcaggttaatgctgctctgaaagcttgcacatatttgaag
ttggatggccttgttatcattggaggtgtaacatcaaacacagatgccgctcatcttgct
gaattttttgctgaagcaaaatgctcaacaaaggtagttggtgttccggtcactattaat
ggagatctcaagaatcagtttgtggaggcaaacgttggtttcgacactatttgcaaggtg
aattctcaactcatcagcaatgtctgcaccgatgccctttcagcagagaagtattattac
ttcgtccgtctcatgggccggaagcattcacatgttgcccttgagtgtacacttcagtct
catccaaacatggtgatactgggcgaggaggttacagcatctaagctcaccatatttgac
atcacaaaacaaatctgtgatgctgtgcaagcaagagcaggacaagacaaaaaccatgga
gtcatcctaattcctgaagggattgtagagagtattcctgaactctatgctctgctgaag
gaaattcatggactgcttaaggagggtgtgcatgctgataacatttctacccagctgtca
ccttggtcatctgctctgtttgagtttttgcctccgttcattaagaaacagctacttctt
catcccgagtctgatgattctgctcagctctcccagattgagacagagaaacttctagct
tatctggtggagactgaaatgaacaagcgcacgaaagaaggaacatacaaagggaagaag
ttcaacgctatctgccacttttttggttaccaagctcgtggatctctaccatcaaaattc
gactgtgactatgcctatgtccttgggcgtatatgttaccacatccttgcagctggtttg
aacggctacatggcaactgtgactaacctaaagagtcctgtaaacaaatggaagtgtggc
gccgcacctatgacggcaatgatgacggttaagcgctggtcccaaaactctggttcaacc
tcgataggaagaccagcgattcacccagctacggtggacttaaaaggcaaagcatacgag
ctattgagacaaaatgcgcagaagttcttgatggaagacatgtacagaaacccaggaccg
gttcagtatgatggaccaggtgcagatgcaaaggcggtaagcctgtgtgttgaagaccaa
gattacatggggagaatcaagaagctgcaggagtatctcgatcaggtgaggacgctggtg
aaaccgggatgctctcaagatgtattgaaagcggcactgagcgtaatggcttcggtgact
gatgttctctccacaatctcatcttcttccaccagcggtcaacaatttgcttaa

KEGG   Brassica napus (rape): 106445093Help
Entry
106445093         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1-like
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445093
   00030 Pentose phosphate pathway
    106445093
   00051 Fructose and mannose metabolism
    106445093
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106445093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106445093
NCBI-ProteinID: XP_013742044
AA seq 619 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEASDSHIIARAFTHT
LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST
LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV
NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVSNLKSPVNKWKCG
AAPITAMMTVKNWSQNASSTSTSIGRPAIHPAMVDLTGKAYELLRQNADKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSSSNGGQQFA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggattcagatttcggaatcccaagagagctctctcctcttcagcaactccgctctcag
taccagcccgagcttcctccttgcctccagggaactaccgtgcgcgtggagtttggtgat
ggaaccactgtggctgaggcctctgattcccatatcatagctcgcgccttcactcatacc
ttaggccagcctttggctcacttcctcagggaagctgccaaagtttctgatgctcacatc
attactcagcttccttctatcagagttggaatcgtgttttgtggaaggcaagctccgggt
ggacacaatgtaatctggggtctttacgaggctcttaaagtgcacaacgccaaaagcacc
ttgcttggctttttgggtggctcggaaggtctgtttgctcaaaagactctggagatcaca
gatgatatactccagacttacaaaaaccaaggtggctatgatttgcttggaagaaccaag
gatcagatcagaaccactgagcaggttaacgctgctctcaaagcttgcactgatttgaag
ctagatggccttgttatcattggaggtgtaacatcaaacacagatgccgctcatcttgct
gaatttttcgctgaagcaaagtgctcaacaaaggtagttggtgtaccagtcactacaaat
ggagatctcaagaatcagtttgtggaggcaaacgttggttttgacaccatatgcaaggtg
aattctcagctcattagcaatgcctgcactgatgctctctctgcagagaagtactattac
ttcatccgtcttatgggtcgaaagcactctcatgttgcccttgagtgtaccctccagtct
catccaaacatggtgatactgggcgaggaggtcgcagcatctaagctcaccatttttgac
atttctaagcagatctgtgatgcagttcaagcaagagcaggacaagacaagaatcatgga
gtcatcctcattcccgaagggatcatagagagtatccctgaagtctacgctctgctaaag
gaaattcatgggctacttagggagggtgtagctgctgataagatctctactcagctctca
ccttggtcatctgctttgtttgaattccttcctccattcattaagaaacagctacttctt
catcctgagtctgatgattctgctcagctatcccaaattgagacggagaagcttctggcg
tatctcgtggagactgaaatgaacaagcgcttgaaagaaggcacatacaaggggaagaag
ttcaatgctatttgtcacttctttggttaccaagctcgtggatctctcccatcgaagttc
gattgtgattatgcatacgtgcttggacatatttgttaccacatcctcgcagctggtttg
aatggttacatggcaacagtgagcaacctgaaaagtcctgtaaacaagtggaagtgtggt
gctgcacctattacagcgatgatgacggtgaagaactggtcccaaaatgctagttctact
tcaacttcaattggtagacctgcaattcatccagcaatggtagatctgacaggcaaagca
tacgagctgttgagacagaacgcagataaattcttgatggaagatctgtacagaaaccca
ggaccgcttcagtacgatggtccaggtgcagatgctaaagcagtgagtctctgcgttgaa
gatcaagactacatgggacgtatcaagaagctccaggaatatctagaccaggtgaggaca
atagtgaagccaggatgttcacaagacgtactgaaagcagcactgagcgtgatggcttca
gtgactgatgtccttactaccatttcttcatcttcaaatggtggtcaacagttcgcttaa

KEGG   Brassica napus (rape): 106450749Help
Entry
106450749         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106450749
   00030 Pentose phosphate pathway
    106450749
   00051 Fructose and mannose metabolism
    106450749
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     106450749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106450749
NCBI-ProteinID: XP_013747940
UniProt: A0A078GX24
AA seq 566 aa AA seqDB search
MAPSLAAVNRDLAAASPDNAPAKGRASVYSEVQSSRINNALPLPSVLKGAFKTVEGPASS
AAGNPDEIAKLFPGLYGQPSVSVVPDQSADLSGQKLKIGVVLSGGQAPGGHNVISGLFDY
LQERAKGSTFYGFKGGPAGIMKCKYVELNAEYILPYRNQGGFDMICSGRDKIETPEQFKQ
AEETAKKLDLDGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKCKEVPTS
FGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEV
SAQKQTLKNVTDYMVDVICKRAELGYNYGVILIPEGLIDFIPEVQELIAELNEILANEVV
DESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQMVETELEK
RKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGLISSVGNL
AAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEWALKNRYI
SPGPIQFTGPGSDALSHTLLLELGAQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggccccttcgctcgccgccgttaaccgagatctcgccgccgcatctccggacaacgct
ccggcgaaaggacgtgcttcggtctacagcgaagtccagtctagccggatcaacaacgcc
cttcctttgccttccgtactcaaaggagccttcaaaaccgtcgaaggacccgctagctcc
gccgccgggaacccagatgagattgccaagttgtttcctggtctgtatggtcagccgtct
gtgtcagttgttccagatcagagtgcagatttatcgggacagaagctgaagatcggagtt
gttttgtctggtggtcaggcgcctggtggacacaatgtgatctctggattgttcgattac
ttgcaggagcgtgctaaaggaagcaccttttacgggtttaagggtggtccagctggtatc
atgaagtgcaaatacgttgagttgaatgctgagtacattcttccttacaggaaccagggt
gggtttgacatgatctgcagtggaagagacaagattgaaacgcctgagcagtttaaacaa
gctgaagaaacagcaaagaaactagatttggatggattggtggttatcggtggagatgac
tccaacaccaatgcttgtctccttgctgaaaacttcaggagtaagaacttgaaaaccaga
gtcattgggtgccccaagaccattgatggtgatttgaaatgcaaggaggttcctaccagt
tttgggtttgatacagcttgcaagatttactctgaaatgattggaaatgtcatgattgat
gcaaggtcaactggaaagtactatcattttgtacgacttatgggtcgtgctgcttcccac
atcacgcttgagtgtgctttacaaactcacccaaacataaccattattggagaagaggtg
tctgcccagaagcagactttgaagaatgtcacggactacatggttgatgttatctgcaag
cgtgctgaacttggttacaactacggtgttattctgattccagaaggtttgatcgatttt
attcccgaggttcaggagctgatcgcagaactgaatgaaattcttgcaaatgaggtggtt
gatgaaagtggactgtggaagaagaagctcaccgaacaatccctgaagctgtttgatctt
ctgcctgaagcgattcaggaacagctgatgctcgaaagagacccacatggaaatgtccag
gtggccaagattgagactgagaagatgcttattcaaatggttgaaactgaactggagaaa
agaaagcaagctggttcatacaagggacaattcatggggcagtctcatttcttcgggtat
gaaggaagatgcggtttgcctacaaattttgatgcaacctactgttacgcacttggttat
ggcgctggagttctcctcaacagtggaaaaaccggactgatttcttcggtcgggaacttg
gctgctccagtggaagaatggactgtaggtgggactgctctcacagccttgatggatgtc
gagaggagacacggtaagttcaagcctgtgatcaagaaagcaatggtggaacttgaaggt
gcgccgtttaagaaattcgcatcgctgcgtgaggagtgggctttgaagaaccgatacatc
agccctggtccaatccagttcacgggacctggttcggatgctctcagccacactctactt
ctcgaactcggggctcaataa

KEGG   Brassica napus (rape): 111207208Help
Entry
111207208         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 2
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111207208
   00030 Pentose phosphate pathway
    111207208
   00051 Fructose and mannose metabolism
    111207208
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     111207208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111207208
NCBI-ProteinID: XP_022560749
AA seq 617 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGTTVRVEFGDGTTVAKAGDAHIIARAFPHT
LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT
LLGFLGGSEGLFAQKALEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICKV
NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD
ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADNISTKLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRTKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCG
AAPMTAMMTVKRWSQNCGSTSIGRPAIHPATVDLKGKAYELLRQNEQKFLMEDMYRNPGP
VQYDGPGADVKAVTLCVEDQDYMGRIKKLQEYLDQVRTLVKPGCSQDVLKAALSVMASVT
DVLSTISSSSTSGQQFA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggattcagatttcggaatccccagagagctctctcctcttcaacagctccgatctcag
taccagcctcagctccctccttgtctccaggggacaactgttcgcgttgaatttggtgat
ggaaccactgtggcaaaagctggtgatgctcacatcattgcacgtgccttcccgcatact
ctaggtcagcctttggctcacttccttagggcgactgccaaagttcctgatgctcagatc
atcaccgagcatccagccattagggttggaattgtgttttctggaaggcaggctcctggt
ggtcacaatgtgatttggggtctttatgaggctctcaaagtgcataacgcaaagaacact
ctgctaggatttttgggtggttctgaaggtctatttgctcaaaaggccctggagatcact
gatgatgtcctccaaacctacaaaaaccaaggtggctttgatttgcttggaagaaccaag
gatcagattagaacaaccgagcaggttaatgctgctctgaaagcttgcacagatttgaag
ttggatggccttgttatcattggaggtgtaacatccaacacagatgccgctcatcttgct
gaattttttgctgaagcaaaatgctcaacaaaggttgttggtgttccggtcactattaat
ggggatctcaagaatcagtttgtggaggcaaacgttggtttcgacactatatgcaaggtg
aattctcaactcatcagcaatgtctgcaccgatgccctttcagcagagaagtattattac
ttcgtccgtctcatgggccggaagcattcacatgttgcccttgagtgtacacttcagtct
catccaaacatggtgatactgggtgaggaggttacagcatctaagctcacgatatttgac
atcaccaaacaaatctgtgatgctgtgcaagcaagagcaggacaagacaaaaatcatgga
gtcatcctaattcctgaagggatcgtagagagtattcctgaactctatgctctgttgaag
gaaattcatggactgcttaaggagggtgttcatgctgataacatttctactaagctgtca
ccttggtcatctgccttgtttgagttcttgcctccattcattaagaaacagctacttctg
catcccgagtctgatgattctgctcagctctcccagattgagacagagaaactcctagct
tatcttgtggagactgaaatgaacaagcgcacgaaagaaggaacatacaaggggaagaag
ttcaacgctatctgtcacttttttggttaccaagctcgtggatctctcccatcaaaattc
gactgtgactatgcctatgtccttgggcatatatgttaccacatccttgcagctggtttg
aacggctacatggcaactgtgactaacctgaagagtcctgtaaacaaatggaaatgtggc
gccgcacctatgacggcaatgatgacggttaagcgctggtcccaaaactgtggttcaacc
tcaataggcagaccagcaattcatccagctacggtggacttgaaaggcaaagcatacgag
ctattgagacaaaatgagcagaaattcttgatggaagatatgtacagaaacccaggaccg
gttcagtacgatggtccaggtgcagatgtaaaggcggtaactctgtgtgttgaagaccaa
gattacatggggagaatcaagaagctgcaggagtatcttgatcaggtgaggacgctagtg
aaaccgggatgctctcaagatgtattgaaagcggcactgagcgtaatggcttcggtgact
gatgtgctctccacaatctcatcttcttccaccagcggtcaacaatttgcttaa

KEGG   Brassica napus (rape): 111212453Help
Entry
111212453         CDS       T04128                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111212453
   00030 Pentose phosphate pathway
    111212453
   00051 Fructose and mannose metabolism
    111212453
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     111212453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111212453
NCBI-ProteinID: XP_022569718
AA seq 619 aa AA seqDB search
MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT
LGQPLAHFLRETAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST
LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK
LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV
NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCG
AAPITAMMTVKNWSQNAGSTSTSIGRPAIHPAMVDLKGKAYELLRQNAEKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSSSNGGQQTA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggattcagacttcggaatccccagagaactctctcctcttcagcaactccgctctcag
taccaacctgagctccctccttgtctccagggaactactgtccgcgtggagcttggtgat
ggaaccaccgtgtccgaggcctctgattcccacatcatagctcgcgccttcccacataca
ttaggacagcctttggctcacttcctcagggaaaccgccaaagtctctgatgctcacatc
attactcagcttccatctatcagagttggaatcgtcttctgtggaaggcaagctccgggc
ggtcacaatgttatctggggtctctacgaggctcttaaggttcacaacgctaaaagcact
ttgcttggcttcttgggtggttcagaaggtctatttgcgcaaaagactctggagatcaca
gatgatatactccagacttacaagaaccaaggtggttatgatttgctgggaagaaccaag
gatcagatcagaaccactgagcaggtcaacgctgcactcaaagcttgcactgatctgaag
ttagatggccttgttatcattggaggtgtgacatcaaacactgatgctgctcatcttgct
gagtttttcgctgaagcaaaatgctccacaaaggtagttggtgttccagttactacaaat
ggagatctcaagaatcagtttgtggaggcaaacgttggttttgacaccatatgcaaggtg
aattctcagctcattagtaatgcatgcactgatgctctatctgcagagaagtactattat
ttcatccgtctcatgggtcggaagcactctcatgttgcacttgagtgtaccctccagtct
catccaaacatggtgatactgggagaggaggttgcagcatccaagctcaccatttttgac
atttctaaacagatctgtgatgcagttcaagcaagagcaggacaagacaagaatcatgga
gtcatcctcattccggaagggatcatagagagcattcctgaagtctacgctctgttaaag
gaaattcacgggctacttagggagggtgtagctgctgataagatatctactcagctctca
ccttggtcatctgctctgtttgaatttctccctccattcattaagaaacagctacttctc
caccccgagtctgatgattctgctcagctatcccagattgagacggagaagcttcttgcg
tatctcgtggagactgaaatgaacaagcgcttgaaagaaggcacatacaagggcaagaag
ttcaatgctatatgtcacttctttggttaccaagctcgtggatctctcccatccaaattc
gactgtgactatgcctacgttcttggacatatatgttaccacatactcgcagctggtctg
aatggctacatggcaacagtgaccaacttaaagagtcctgtaaacaagtggaaatgtggt
gctgcacctattacagcaatgatgacggtgaagaactggtcccaaaacgctggttctaca
tcaacttcaatcggtagacctgcaattcatccggcaatggtggatttgaaaggcaaagca
tacgagctgttgagacagaacgcagagaaattcttgatggaagatctgtacaggaaccca
ggaccgcttcagtacgatggacctggcgcagatgctaaagcagtgagtctctgtgttgaa
gatcaagattacatgggacgtatcaagaagctgcaagaatatctagaccaggtgaggacg
atagtgaagccagggtgttctcaagacgtactgaaagcagcactgagcgtgatggcttca
gtgactgatgttctcaccaccatttcttcatcttcaaatggtggtcaacaaactgcttag

DBGET integrated database retrieval system