KEGG   Brassica napus (rape): 106348054Help
Entry
106348054         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106348054
   00030 Pentose phosphate pathway
    106348054
   00051 Fructose and mannose metabolism
    106348054
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106348054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106348054
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106348054
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106348054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 106348054
NCBI-ProteinID: XP_013643153
AA seq 413 aa AA seqDB search
MLQVETIMQSLTITLYPTSISPPSLDLFPLRQITASVLYPPTAGYNRRGMASRGDSASFK
SLAARQTSISSDDDGYCTLVDFAGNGGGGRQGTTVGDDLVVLLYHLQHACKRIASLVASP
FNSSLGKLSVNSSSGSDRDAPKPLDIVSNDIILSSLRNSGKVAVMASEEDDTPTWIKDDG
PYVVVVDPLDGSRNIDASIPTGTIFGIYSRLVELDHLPVEEKAELNSLQRGNRLVASGYV
LYSSATILCVTLGSGTHAFTLDHSTGEFVLTHQNIKIPTRGQIYSVNDARYFDWPEGLRK
YIDTVRQGKGQNPKKYSARYICSLVADLHRTLLYGGVAMNPRDHLRLVYEGNPLAFLVEQ
AGGKASDGKREILSIQPVKLHQRLPLFLGSVEDVTELESYGDVQQTVNPGYEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgctccaagttgagacaataatgcaatctcttactataactctgtacccaacttcaatt
tccccgccaagtctcgatctctttccgcttagacaaatcaccgcttctgttctctatcct
ccaaccgccggatacaaccgccgcggcatggcgtcccgcggcgattctgcttcgtttaag
tccctagcggctcgtcagacttcgatcagtagtgatgacgatggttactgtactctcgta
gactttgcaggtaatggaggaggagggagacaaggtacgactgtaggagatgatcttgtg
gtgttactttaccacttgcaacatgcctgcaaaagaatagcttctcttgtcgcttctcct
ttcaactcctcacttggaaagctctctgtcaactcctctagtggctctgaccgagatgct
cctaagccgcttgatattgtctctaacgatatcatcttgtcatctctcagaaactcaggg
aaagtagcagtaatggcttcagaagaagacgatactcccacttggataaaagatgacggt
ccttacgttgtggttgtagatcctttagatggttcgcgtaacatcgatgcttctataccc
actggaactatatttgggatttacagtcgactcgttgagcttgatcatttacctgttgaa
gagaaagctgagctcaattctctgcagagaggaaacaggcttgtagcttccggttacgtg
ctgtactcttcagccacgatactctgcgttactcttggctctggtacacatgccttcacg
cttgatcattccacgggggagttcgttcttacacatcagaacattaaaatccctactcga
ggacaaatctactcagtgaatgatgcgaggtacttcgactggccagaaggtttgaggaag
tatattgatacggtacgacaagggaaaggccaaaacccgaagaaatactcagcccgttat
atttgttctctagtggctgatcttcacaggacactgttatacggaggagtggctatgaat
ccaagagaccatctccgtttagtctatgaaggaaaccctttggcttttctagtggaacaa
gctggtggtaaagcctctgatggaaagagagagatactttcgatacagccagtgaagctt
caccagaggttgcctctgtttcttgggagtgtagaggatgtgactgagcttgagagctat
ggagatgtgcagcagactgtgaaccctggctacgaagtttga

KEGG   Brassica napus (rape): 106382775Help
Entry
106382775         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase 1, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106382775
   00030 Pentose phosphate pathway
    106382775
   00051 Fructose and mannose metabolism
    106382775
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106382775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106382775
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106382775
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106382775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106382775
NCBI-ProteinID: XP_013678289
UniProt: A0A078J9M5
AA seq 414 aa AA seqDB search
MAATAATTSSSHLLLSSSRHLASSSQPRILFQRSLFSGGKRAGKNHHAAGGVRCMAVAAD
ASAEAKPAARKKSGYELQTLTGWLLRQEQKGEIDTEMTIVMSSIAMACKQIASLVQRAGI
SNLTGVQGAVNIQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEESYSGNY
IVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECIVDDSDDISALGSEEQRCIVNVCQPGNN
LLAAGYCMYSSSVIFVLTLGKGVFSFTLDPMYGEFVLTQENIEIPKAGKIYSFNEGNYQM
WDEKLKKYIDDLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKLRLL
YECAPMSFIVEQAGGKGSDGHQRVLDIQPTEIHQRVPLYIGSKDEVEKLEKYLA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccgccgcaacaacctcgtcgtctcatcttcttctctcaagctctcgtcac
ttagcatcctcatctcagccacgaatccttttccagagatctctgttttccggcgggaaa
cgggctgggaaaaaccatcatgctgctggtggagtgaggtgtatggcggttgcagcggat
gcttcggcggaggctaagccggcggcgaggaagaagagtgggtacgagcttcagacgctg
acgggttggttgctgagacaagagcagaaaggagagatagatacagagatgacgatagtg
atgtcgagcatagcgatggcttgtaagcagatcgcttcgcttgtacagcgcgccggaatc
tctaatctgaccggcgttcaaggagctgttaacattcagggagaggatcagaagaagctt
gacgtcgtctctaatgaggtgttttcaaactgtttgagatcaagtggaaggacagggatc
attgcgtcagaggaagaggacgtccccgtagcagttgaagagagttactccggcaactac
attgtcgtcttcgatcctctcgacggttcctccaacatcgacgctgcagtttccaccggt
tcaatcttcggtatctacagccccaatgacgagtgtatcgttgacgactccgacgatatc
tccgctcttgggtcagaagaacaaaggtgtatagtaaacgtgtgtcaaccagggaacaac
ttgctagcagctggctactgtatgtactcgagctcagtcatcttcgttctcaccttaggc
aaaggcgttttctccttcacactcgacccaatgtacggcgagttcgtcctgactcaagag
aacattgagatccccaaagcagggaaaatctactctttcaacgaagggaactaccagatg
tgggacgagaaactgaagaagtatatcgatgatctcaaggaccctggtccaagtgggaag
ccttactctgcaaggtacattggtagtttggtcggagactttcacagaactttgttgtat
ggtgggatttacgggtaccctcgtgatgccaagagcaaaaacggtaagcttaggctttta
tatgagtgtgcaccgatgagtttcatcgttgaacaagctggaggaaaaggatcagatggt
caccaaagagtactagatatccaacccaccgagatacatcagagggttccactttacatt
ggaagcaaagacgaagtagagaagctggagaagtacttggcttga

KEGG   Brassica napus (rape): 106399660Help
Entry
106399660         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106399660
   00030 Pentose phosphate pathway
    106399660
   00051 Fructose and mannose metabolism
    106399660
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106399660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106399660
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106399660
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106399660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P Big_3 zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 106399660
NCBI-ProteinID: XP_013695572
AA seq 338 aa AA seqDB search
MDHEADAYRTDLMTITRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLI
GLAGETNIQGEEQKKLDVLSNDVFVKALVSSGRTSVLVSEEDEEATLVESSKRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYTMSHNDEPTTEDVLKPGHEMVAAGYCMYGSSCMLVLST
GTGVNGFTLDPSLGEFILTHPDIKIPKKGNIYSVNEGNAQNWDGPTTKYVEKCKFPKDGS
PAKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKKRALDLVPEKIHERSPIFLGSYEDVEEIKALYAAEE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgaagcagatgcataccgtacggatctgatgaccatcacgaggttcgtgctg
aatgagcaatcaaagtacccagagtctcgtggggatttcaccattttgctaagcaacatc
gttttgggatgcaaattcgtctgcagtgctgtcaacaaggctggtttggccaagcttatt
ggacttgctggggaaacaaatatccagggtgaagagcaaaagaaactcgatgtgctctcc
aacgatgtctttgtcaaagctttggttagcagtggcagaacctctgttcttgtctcagaa
gaagatgaggaagctacgttagtggagtcatccaagcgtggaaagtactgtgttgttttt
gatccacttgatggatcctcaaacatcgactgtggtgtctccattggaaccatctttggg
atttacacaatgagccacaatgatgagccaactactgaagatgtcttgaaacctgggcat
gaaatggttgcagcgggttactgtatgtacggaagctcctgcatgcttgtgttgagcact
ggaaccggtgtcaatggatttaccctggacccatctctaggagagttcatattaactcac
ccggacattaagattccgaaaaagggaaacatctattcagtgaatgaaggcaatgctcag
aactgggatggtccaaccacaaagtatgtagagaaatgcaagtttcctaaagatggttct
cccgctaagtccctgagatatgtgggaagtatggtagccgatgttcatcgcacactgctt
tatggaggaatcttcttgtacccggctgacaagaaaagccccaatgggaaattgcgtgtt
ctgtatgaagtcttcccgatgtcgttcttgatggagcaagccggaggccaggccttcact
ggcaagaaaagggcgctcgaccttgtgccggagaagatccatgagcgttctcctatattt
cttggtagctacgaagatgtagaggagattaaggctctgtatgctgcagaggaatag

KEGG   Brassica napus (rape): 106401056Help
Entry
106401056         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106401056
   00030 Pentose phosphate pathway
    106401056
   00051 Fructose and mannose metabolism
    106401056
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106401056
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106401056
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106401056
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106401056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Big_3 Inositol_P zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 106401056
NCBI-ProteinID: NP_001302604
UniProt: P46267
AA seq 339 aa AA seqDB search
MDHEADAFRDLMTITRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLIG
LAGDTNIQGEEQKKLDVLSNDVFVKALVSSGRTSVLVSEEDEEATFVESSKCGKYCVVFD
PLDGSSNIDCGVSIGTIFGIYTMEHSDEPTTKDVLKPGNEMVAAGYCMYGSSCMLVLSTG
TGVHGFTLDPSLGEFILTHPDIKIPKKGNIYSVNEGNAQNWDGPTTKYVERCKYPKDGSP
AKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMAFLMEQAGGQAFTG
KKRALDLVPKKIHERSPIFLGSYDDVEEIKALYAEEEKN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgaagcagatgctttccgtgatttgatgaccatcacgagattcgtgctgaat
gagcaatcaaagtatccagagtctcgtggggatttcacgattttgctcagcaacatcgtt
ttgggatgcaaattcgtctgcagtgccgtcaacaaggctggtttggccaagcttattgga
cttgcaggggacacaaatatccagggtgaagagcaaaagaaactggatgtgctctctaac
gatgtttttgtcaaagctttggttagcagcggcagaacttctgttcttgtctcggaagaa
gatgaggaagctacgtttgtggagtcatccaagtgtggaaagtactgtgttgtttttgat
ccacttgatggatcctcaaacattgactgtggtgtctccattggaacaatctttggaatt
tacacaatggaacacagtgatgagccgactactaaagatgttctgaaacctgggaatgaa
atggttgcagcgggttactgtatgtacggaagctcctgcatgcttgtgttgagcacagga
acaggtgtccacggatttaccctggacccatctctaggagagttcatattaactcaccca
gacattaagattccaaagaagggaaacatatactcagtgaatgaaggaaatgctcagaac
tgggatggtccaaccacaaaatatgtagagagatgcaagtatcccaaagatggttctccc
gcaaagtcactgagatatgtcggaagtatggtagccgatgttcatcgcactctgctttat
ggaggaatcttcctgtacccggctgacaagaaaagccccaatgggaaattgcgtgtcctg
tatgaagtcttcccaatggcgttcttgatggagcaagctggaggtcaggccttcactggc
aagaaaagggcactggaccttgtcccgaaaaagatccatgagcgttctcccatatttctt
ggtagctatgacgatgtagaggagattaaggctctgtatgcggaggaggagaagaactaa

KEGG   Brassica napus (rape): 106415159Help
Entry
106415159         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106415159
   00030 Pentose phosphate pathway
    106415159
   00051 Fructose and mannose metabolism
    106415159
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106415159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106415159
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106415159
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106415159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106415159
NCBI-ProteinID: NP_001302741
UniProt: Q9ZP29
AA seq 417 aa AA seqDB search
MAATAATTSSSHLLLSSSRHVAASSQPQILFQRSLFSGGKRSAAGKNHHASGGVRCMAVA
ADASAEAKPAAARKKSGYELQTLTGWLLRQEQKGEIDTELTIVMSSIAMACKQIASLVQR
AGISNLTGVQGAVNIQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEESYS
GNYIVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECIVDDSDDISSLGSEEQRCIVNVCQP
GNNLLAAGYCMYSSSVIFVLTLGKGVFSFTLDPMYGEFVLTQENIEIPKAGKIYSFNEGN
YQMWDEKLKKYIDDLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKL
RLLYECAPMSFIVEQAGGKGSDGHQRVLDIQPTEIHQRVPLYIGSKEEVEKLEKYLA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccgccgcgacaacgtcatcgtctcatcttcttctctcaagctctcgccac
gtggcagcctcatctcagccacaaatccttttccagagatctctgttttccggcgggaaa
cgatcggcagctggaaaaaaccatcatgctagtggtggagtgaggtgtatggcggttgca
gcggatgcttcggcggaggctaagccggcggcagcgaggaagaagagtgggtacgagctt
cagacgctgacgggttggttgctgagacaagagcagaaaggagagatagatacagagctg
acgatagtgatgtcgagcatagcgatggcttgtaagcagatcgcttcgcttgtacagcgc
gccggaatctctaatctgaccggcgttcaaggagccgttaacattcagggagaggatcag
aaaaagctcgacgtcgtctctaatgaggtattttcaaactgtttgagatcaagtggaagg
acagggatcattgcgtcagaggaagaggacgtccccgtagcagttgaagagagttactcc
ggaaactacattgtcgtctttgatcctctcgacggttcctccaacatcgacgctgcagtc
tccactggttcaatcttcggtatctacagccccaatgacgagtgtatcgttgacgactcc
gacgatatctcctctcttggttcagaagaacaaaggtgtatagtaaacgtgtgtcaacca
gggaacaacttgctcgcagctggctactgtatgtactcgagctcagtcatcttcgttctc
accttaggcaagggcgttttctccttcacactcgacccaatgtacggcgagttcgtcctc
actcaagagaacattgagatccccaaagcagggaaaatctactctttcaacgaagggaac
taccagatgtgggacgagaaactgaagaagtacattgatgatcttaaggaccctggtcca
agtgggaagccttactctgcaaggtacattggtagtttggtcggagactttcacagaact
ttgttgtacggtgggatttacgggtaccctcgtgacgccaagagcaaaaacggtaagctt
aggcttttgtatgagtgtgcaccgatgagtttcatcgttgaacaagctggaggaaaagga
tcagatggccaccaaagagtactagatatccaacccaccgagatacatcagagggttcca
ctttacattggaagcaaagaagaagtagagaagctggagaagtacttggcttga

KEGG   Brassica napus (rape): 106421663Help
Entry
106421663         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106421663
   00030 Pentose phosphate pathway
    106421663
   00051 Fructose and mannose metabolism
    106421663
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106421663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106421663
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106421663
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106421663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106421663
NCBI-ProteinID: NP_001302992
UniProt: Q07204 A0A078FJK5
AA seq 411 aa AA seqDB search
MAATAGATPSSHLLLSSSRHVAASPQPRILFPSLSGKRVAVGKNHHATGVRCMAVAADAT
AETKPAAKKKSGYELQTLTSWLLRQEMKGEIDTELTIVMSSIAMACKQIASLVQRAGISN
LTGVQGAVNIQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEESYSGNYVV
VFDPLDGSSNIDAAVSTGSIFGIYSPNDECLPDSDDTSALGSEEERCIVNVCQPGNNLLA
AGYCMYSSSVIFVLTLGKGVFAFTLDPMYGEFVLTQENIEIPKAGKIYSFNEGNYQMWDE
NLKKYIDDLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKLRLLYEC
APMSFIVEQAGGKGSDGHHRVLDIQPTEIHQRVPLYIGSKEEVEKLEKYLA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccgccggagcaacaccgtcgtctcatcttcttctctcaagctctcgccat
gtggcggcctcacctcagccacgaatccttttcccatctctgagcgggaaacgagtagca
gttgggaaaaaccatcatgctactggagtgaggtgtatggcggttgcggcggatgctacg
gcggagactaaaccggctgcaaagaaaaagagtgggtatgagcttcaaacactgacgagc
tggttgctgagacaggagatgaaaggggagatagatacagagctgacgatagtgatgtcg
agcatagcgatggcttgtaagcagatcgcttcgttagttcagcgggctggaatctctaat
ctgacgggcgttcaaggagctgttaacattcagggagaggatcagaaaaagcttgacgtc
gtctccaacgaggtgttttcgaactgtttgagatcaagtggaagaacgggaatcatagcg
tcggaggaagaggatgtgccagtggcggtggaagaaagttactctggcaactatgtagtc
gtgttcgaccctcttgacggttcctccaacattgacgcagccgtctccacgggttccatc
ttcggtatctacagccccaatgatgagtgtctccccgactccgacgatacctccgctctt
gggtcagaagaagaaaggtgtatagtaaacgtatgccagccagggaataacttgctagca
gctggctactgtatgtactcaagctcagtcatcttcgttcttactttaggcaaaggcgtt
ttcgccttcaccctcgacccaatgtatggcgagttcgtcctcacgcaagagaacattgag
attccgaaagccgggaaaatctactctttcaacgaagggaactaccagatgtgggatgag
aatctaaagaagtacattgatgatctcaaggaccctggtccaagtgggaagccttactca
gcaaggtacattggaagtttggtcggtgattttcataggactttgttgtacggtgggatt
tacgggtaccctcgtgacgccaagagcaaaaacggcaagcttaggcttttgtatgagtgt
gcacctatgagtttcattgttgaacaagccggagggaaaggatcagatggacaccataga
gtcctagatatccaaccgaccgagatacatcagagggttccactctacattggaagcaaa
gaagaagtggagaagctggagaagtacttggcttga

KEGG   Brassica napus (rape): 106426647Help
Entry
106426647         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106426647
   00030 Pentose phosphate pathway
    106426647
   00051 Fructose and mannose metabolism
    106426647
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106426647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106426647
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106426647
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106426647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 106426647
NCBI-ProteinID: XP_013722815
AA seq 433 aa AA seqDB search
MLWLWNTSSREAYPDERLESSANALNSEKIMQSLPTTLYPTSVSPPSLDLYPLRQTVSSV
LSPPTAGYNRRGMVSRGESASFKPLAARQTSISGDGDGYCTLVDFAGYGGGGANVGDDLV
VLLYHLQHACKRIASLVASPFNSSLGKLSVNSSTGSDRDAPKPLDIVSNDIILSSLRNSG
KVAVMASEEDDTPTWIKDDGPYVVVVDPLDGSRNIDASIPTGTIFGIYNRLVELDHLPVE
EKAELNSLQRGNRLVASGYVLYSSATILCVTLGSGTHAFTLDHSTGEFVLTHQNIKIPPR
GQIYSVNDARYFDWPKGLRKYIDTVRQGKGQNPKKYSARYICSLVADLHRTLLYGGVAMN
PRDHLRLVYEGNPLAYLVEQAGGKASDGKREILSIQPVKLHQRLPLFLGSVEDVTELESY
GDVQQTVNPGYEV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggttatggaatacgtcatcgcgtgaagcgtatccagatgagagactcgagagt
tctgcgaatgctctgaactcagaaaaaataatgcaatctctccctacaactctgtaccca
acttcagtttccccgccaagtctcgatctttacccgctaagacaaaccgtatcttctgtt
ctctctcctccaaccgccggatataaccgtcgcggcatggtgtctcgcggtgagtctgct
tcgtttaagcccctcgccgcccgtcagacttcgatcagtggtgatggtgatggatactgt
actctcgtagactttgcaggttatggaggaggaggtgcaaatgtaggagatgatcttgtg
gtgttgctttaccacttgcaacatgcctgtaaaagaatcgcttctcttgtcgcttctcct
ttcaactcttcacttggaaagctctctgtcaactcctctactggctctgaccgagacgcg
cctaagccgcttgatattgtctcgaacgatatcatcttgtcatctctcagaaactcaggg
aaagtagcagtaatggcttcagaagaagacgatactcccacttggataaaagatgatggt
ccttacgttgtggttgtagatcctttagatggttcacgtaacatcgatgcttcgataccc
actggaactatatttgggatttacaatcgactcgttgagcttgatcatttacctgttgaa
gagaaagctgagctcaactctctgcagagaggaaacaggcttgtagcttccggttacgtg
ctgtactcttcagccacgatactctgcgttactcttggctctggaacacatgccttcacg
cttgatcattccacgggcgagttcgttcttacacatcaaaacattaagatccctcctcga
ggacaaatctactcggtgaatgatgcgaggtacttcgactggccaaaaggtttgaggaag
tacattgatacggtacgacaagggaaaggccagaacccgaagaagtactcggcacgttac
atttgttctctggtggctgatcttcacaggacactgttatacggaggagtggctatgaat
ccaagagaccatctccgtttagtctacgaaggaaaccctttggcttatctagtggaacaa
gctggtggcaaagcctctgacggaaagagagagatactttcgatacagccagtgaagctt
caccagaggttgcctctgtttcttgggagcgtagaggatgtgactgagcttgagagctat
ggagatgtgcagcagactgtgaaccctggctatgaagtttga

KEGG   Brassica napus (rape): 106437677Help
Entry
106437677         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106437677
   00030 Pentose phosphate pathway
    106437677
   00051 Fructose and mannose metabolism
    106437677
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106437677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106437677
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106437677
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106437677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P Big_3 zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 106437677
NCBI-ProteinID: XP_013734058
AA seq 338 aa AA seqDB search
MDHEADAYRTDLMTITRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLI
GLAGETNIQGEEQKKLDVLSNDVFVKALVSSGRTSVLVSEEDEEATLVESSKRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYTMSHNDEPTTEDVLKPGNEMVAAGYCMYGSSCMLVLST
GTGVNGFTLDPSLGEFILTHPDIKIPKKGNIYSVNEGNAQNWDGPTTKYVEKCKFPKDGS
PAKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKKRALDLVPEKIHERSPIFLGSYEDVEEIKALYAAEE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgaagcagatgcataccgtacggatttgatgaccatcacgaggttcgtgctg
aatgagcaatcaaagtacccagagtctcgtggggatttcaccatattgctaagcaacatc
gttttgggatgcaaattcgtctgcagtgctgtcaacaaggctggtttggccaagcttatt
ggacttgctggggaaacaaatatccagggtgaagagcaaaagaaactcgatgtgctctcc
aacgatgtctttgtcaaagctttggttagcagtggcagaacctctgttcttgtctcagaa
gaagatgaggaagctacgttagtggagtcatccaagcgtggaaagtactgtgttgttttt
gatccacttgatggatcctcaaacatcgactgtggtgtctccattggaaccatctttggg
atttacacaatgagccacaatgatgagccaactactgaagatgtcttgaaacctgggaat
gaaatggttgcagcgggttactgtatgtacggaagctcctgcatgcttgtgttgagcact
ggaaccggtgtcaatggatttaccctggacccatctctaggagagttcatattaactcac
ccggacattaagattccgaaaaagggaaacatctattcagtgaatgaaggcaatgctcag
aactgggatggtccaaccacaaagtatgtagagaaatgcaagtttcctaaagatggttct
cccgctaagtctctgagatatgtgggaagtatggtagccgatgttcatcgcacactgctt
tatggaggaatcttcttgtacccggctgacaagaaaagccccaatgggaaactgcgtgtt
ctgtatgaagtcttcccgatgtcgttcttgatggagcaagccggaggccaggccttcact
ggcaagaaaagggcgctagaccttgtgccggagaagatccatgagcgttctccaatattt
cttggtagctacgaagatgtagaggagattaaggctctgtatgctgcagaggaatag

KEGG   Brassica napus (rape): 106445523Help
Entry
106445523         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445523
   00030 Pentose phosphate pathway
    106445523
   00051 Fructose and mannose metabolism
    106445523
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106445523
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     106445523
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106445523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 106445523
NCBI-ProteinID: XP_013742547
AA seq 412 aa AA seqDB search
MAATAGTASSSHLLLSSSRHVAASPQPRILFPSLSGKRVAVGKNHHATGVRCMAVAADAT
AETKPAAKKKSGYELQTLTSWLLRQEMKGEIDTELTIVMSSIAMACKQIASLVQRAGISN
LTGVQGAVNIQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEESYSGNYVV
VFDPLDGSSNIDAAVSTGSIFGIYSPNDECLPDNSDDTSALGSEEERCIVNVCQPGNNLL
AAGYCMYSSSVIFVLTLGKGVFAFTLDPMYGEFVLTQENIEIPKAGKIYSFNEGNYQMWD
ENLKKYIDDLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKLRLLYE
CAPMSFIVEQAGGKGSDGHQRVLDIQPTEIHQRVPLYIGSKEEVEKLEKYLA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaccgccggaacagcatcatcgtctcatcttcttctctcaagctctcgccat
gtggcggcctcacctcagccacgaatccttttcccatctctgagcgggaaacgagtagca
gttgggaaaaaccatcatgctactggagtgaggtgtatggcggttgcggcggatgctacg
gcggagactaaaccggctgcaaagaagaagagtgggtatgagcttcagacactcacgagc
tggttgctgagacaggagatgaaaggggagatagatacagagctgacgatagttatgtcg
agcatagcgatggcatgtaagcagatcgcttcgctagttcagcgcgccggaatctctaat
ctgactggcgttcaaggagctgttaacattcagggagaggatcagaagaagcttgacgtc
gtctctaatgaggtgttttcgaactgtttgagatcaagtggaagaacgggaatcatagcg
tctgaggaagaggatgtgccagtggctgtggaggaaagttactccggcaactacgttgtc
gtgtttgaccctcttgacggctcctctaacattgacgccgctgtctctaccggttctatc
tttggtatctacagccccaatgacgagtgtctacccgacaactccgacgacacctctgct
cttgggtcagaagaagaaaggtgtatagtaaacgtgtgccagccagggaacaacttgcta
gcagctggctactgtatgtactcaagctcagtcatcttcgttcttactttaggcaaaggc
gtttttgccttcacactcgacccaatgtatggagagttcgtcctcacgcaagagaacatt
gagattccgaaagccgggaaaatctactctttcaacgaagggaactaccagatgtgggac
gagaatctgaagaagtacattgatgatctcaaggatcctggtccaagtgggaagccttac
tcagcaaggtacattggaagtttggtcggtgattttcataggactttattgtacggtggg
atttacgggtaccctcgtgacgccaagagcaaaaacggcaagcttaggcttttgtatgag
tgtgcacctatgagtttcatcgttgaacaagccggaggtaaaggatcagatggacaccag
agagtcctagatatccaaccgaccgagatacatcagagggttccactctacattggaagc
aaagaagaagtggagaagctggagaagtacttggcttga

KEGG   Brassica napus (rape): 111211517Help
Entry
111211517         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111211517
   00030 Pentose phosphate pathway
    111211517
   00051 Fructose and mannose metabolism
    111211517
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111211517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111211517
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     111211517
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111211517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 111211517
NCBI-ProteinID: XP_022568390
AA seq 317 aa AA seqDB search
MFSGVTCSSRMIMSIPWSSPPFVTLGASQNLSSNTSTALVERRTFKSKNNRYPLIITGRA
RKKDGSRRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLIGLAGDTNIQ
GEEQKKLNVLSNDVFVKALVSSGRTSVLVPEEDEEATFVESSKRGKYCVVFDPLDGSSNI
DCGVSIGTIFGIYTMEHSDEPTTEDVLKPGNEMVAAGYCMYGSSCMLVLSTGTGVNGFTL
DPSLGEFILTHPDIKIPKKGNIYSVNEGNAQNWDGPTTKYVERCKYPKDGSPAKSLRYVG
SMVADVHPTLLYGGIFL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggagttacctgttcatcgaggatgatcatgtccattccctggagctctcct
cctttcgtcacattaggtgcctcccagaacctaagcagtaacacctccacagccttagta
gaacgacgaactttcaaatcgaagaacaataggtatccgctgatcataacggggagagcg
agaaagaaagatggatcacgaagattcgtgctgaatgagcaatcaaagtatccagagtct
cgtggggatttcaccattttgctcagcaacatcgttttgggatgcaaattcgtctgcagt
gccgtcaacaaggctggtttggccaagcttattggacttgcaggggacacaaatatccag
ggtgaagagcaaaagaaactgaatgtgctctctaacgatgtttttgtcaaggctttggtt
agcagcggcagaacttctgttcttgtcccggaagaagatgaggaagctacgtttgtggag
tcatccaagcgtggaaagtactgtgttgtttttgatccacttgatggatcctcaaacatt
gactgtggtgtctccattggaacaatctttggaatttacacaatggagcacagtgatgag
ccgacaactgaagatgttctgaaacctgggaatgaaatggttgcagcgggttactgtatg
tacggaagctcctgcatgcttgtgttgagcactggaacaggtgtcaacggatttaccctg
gacccatctctaggagagttcatattaactcacccagacattaagattccaaagaaggga
aacatatactcagtgaatgaaggaaatgctcagaactgggatggtccaaccacaaagtat
gtagagagatgcaagtatcccaaagatggttctcccgcaaagtcactgagatatgtcgga
agtatggtagcagatgttcatcctactctgctttatggaggaatcttcctgtag

KEGG   Brassica napus (rape): 111211519Help
Entry
111211519         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111211519
   00030 Pentose phosphate pathway
    111211519
   00051 Fructose and mannose metabolism
    111211519
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111211519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111211519
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     111211519
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111211519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 111211519
NCBI-ProteinID: XP_022568394
AA seq 317 aa AA seqDB search
MFSGVTCSSRMIMSIPWSSPPFVTLGASQNLSSNTSTALVERRTFKSKNNRYPLIITGRA
RKKDGSRRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLIGLAGDTNIQ
GEEQKKLNVLSNDVFVKALVSSGRTSVLVPEEDEEATFVESSKRGKYCVVFDPLDGSSNI
DCGVSIGTIFGIYTMEHSDEPTTEDVLKPGNEMVAAGYCMYGSSCMLVLSTGTGVNGFTL
DPSLGEFILTHPDIKIPKKGNIYSVNEGNAQNWDGPTTKYVERCKYPKDGSPAKSLRYVG
SMVADVHPTLLYGGIFL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggagttacctgttcatcgaggatgatcatgtccattccctggagctctcct
cctttcgtcacattaggtgcctcccagaacctaagcagtaacacctccacagccttagta
gaacgacgaactttcaaatcgaagaacaataggtatccgctgatcataacggggagagcg
agaaagaaagatggatcacgaagattcgtgctgaatgagcaatcaaagtatccagagtct
cgtggggatttcaccattttgctcagcaacatcgttttgggatgcaaattcgtctgcagt
gccgtcaacaaggctggtttggccaagcttattggacttgcaggggacacaaatatccag
ggtgaagagcaaaagaaactgaatgtgctctctaacgatgtttttgtcaaggctttggtt
agcagcggcagaacttctgttcttgtcccggaagaagatgaggaagctacgtttgtggag
tcatccaagcgtggaaagtactgtgttgtttttgatccacttgatggatcctcaaacatt
gactgtggtgtctccattggaacaatctttggaatttacacaatggagcacagtgatgag
ccgacaactgaagatgttctgaaacctgggaatgaaatggttgcagcgggttactgtatg
tacggaagctcctgcatgcttgtgttgagcactggaacaggtgtcaacggatttaccctg
gacccatctctaggagagttcatattaactcacccagacattaagattccaaagaaggga
aacatatactcagtgaatgaaggaaatgctcagaactgggatggtccaaccacaaagtat
gtagagagatgcaagtatcccaaagatggttctcccgcaaagtcactgagatatgtcgga
agtatggtagcagatgttcatcctactctgctttatggaggaatcttcctgtag

KEGG   Brassica napus (rape): 111213425Help
Entry
111213425         CDS       T04128                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111213425
   00030 Pentose phosphate pathway
    111213425
   00051 Fructose and mannose metabolism
    111213425
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111213425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111213425
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     111213425
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111213425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P Big_3 zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 111213425
NCBI-ProteinID: XP_022570898
AA seq 340 aa AA seqDB search
MDHEADAYRTDLMTITRFVLNEQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLI
GLAGDTNIQGEEQKKLDVLSNDVFVKALVSSGRTSVLVSEEDEEATFVESSKRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYTMEHSDEPTIEDVLKPGNEMVAAGYCMYGSSCMLVLST
GTGVHGFTLDPSLGEFILTHPDIKIPNKGNIYSVNEGNAQNWDGPTTKYVERCKYPKDGS
PAKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMAFLMEQAGGQAFT
GKKRALDLVPKKIHERSPIFLGSYDDVEEIKALYAAEENN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgaagcagatgcttaccgtacggatttgatgaccatcacgagattcgtgctg
aatgagcaatcaaagtatccagagtctcgtggggatttcaccattttgctcagcaacatc
gttttgggatgcaaattcgtctgcagtgccgtcaacaaggctggtttggccaagcttatt
ggacttgcaggggacacaaatatccagggtgaagagcaaaagaaactggatgtgctctct
aacgatgtttttgtcaaagctttagttagcagtggcagaacttctgttcttgtctcggaa
gaagatgaggaagctacgtttgtggagtcatccaagcgtggaaagtactgtgttgttttt
gatccacttgatggatcctcaaacattgactgtggtgtctccattggaacaatctttgga
atttacacaatggagcacagtgatgagccgactattgaagatgttctgaaacctgggaat
gaaatggttgcagcgggttactgtatgtacggaagctcctgcatgcttgtgttgagcact
ggaacaggtgtccacggatttaccctggacccatctctaggagagttcatattaactcac
ccagacattaagattccaaataagggaaacatatactcagtgaatgaaggaaatgctcag
aactgggatggtccaaccacaaagtatgtagagagatgcaagtatcccaaagatggttct
cccgcaaagtcactgagatatgtcggaagtatggtagccgatgttcatcgcactctgctt
tatggaggaatcttcctgtacccggctgacaagaaaagccctaatgggaaattgcgtgtc
ctgtatgaagtcttcccaatggcattcttgatggagcaagctggaggtcaggccttcact
ggcaagaaaagggcactggacctggtcccgaaaaagatccatgagcgttctcccatattt
cttggtagctatgacgatgtagaggagattaaggctctgtatgctgcggaggagaataac
taa

DBGET integrated database retrieval system