KEGG   Brassica napus (rape): 106348917Help
Entry
106348917         CDS       T04128                                 

Definition
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106348917
   00030 Pentose phosphate pathway
    106348917
   00500 Starch and sucrose metabolism
    106348917
   00520 Amino sugar and nucleotide sugar metabolism
    106348917
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106348917
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106348917
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106348917
  Exosomal proteins of other body fluids (saliva and urine)
   106348917
  Exosomal proteins of colorectal cancer cells
   106348917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106348917
NCBI-ProteinID: XP_013644209
AA seq 614 aa AA seqDB search
MASSLSGLFSSSLKPSKTLSVKALSAPPTRGGDSFSFPHTSKPSHLPLTLSASRSDISHT
DAATAAKKELIKDPDALWERYLDWLYQEKDLGLYLDVSRVGFTDEFVVDMEHRFKSAFKA
MDELEKGSIANPDEGRMVGHYWLRNSSLVPKPTLKTLIENTLDSICSFADDIIAGKIKPP
SSPRFTQILSVGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQIAQLGPELAS
TLVIVISKSGGTPETRNGLLEVQKAFREAGLNFAKQGVAITQENSLLDNTARIEGWLARF
PMYDWVGGRTSVMSAVGLLPAALQGIDIREMLAGAAIMDEATRTTSLKNNPAALLAMCWY
WASDGVGSKDMVILPYKDSLLLFSRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTD
QHAYIQQLREGVHNFFATFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGR
ESISVTIEEVTPRSVGAIIALYERAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRV
LSVLNEASCKDPVEPLTLDEIADRCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSV
KVYLGECNVDDMYA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctctctcaggcctcttctcttcctctctcaaaccgtccaaaaccctctcc
gtcaaagcattgtcggcgccgccgacaagaggaggagactccttctctttcccacacacc
tccaaaccctcacacctaccgttgactctctccgcttctcgctccgacatttctcacacg
gacgccgccaccgccgccaagaaggagctgatcaaagatccagatgcgctctgggagcgg
tacctcgattggctgtatcaggagaaggacctcgggctgtatctcgacgtcagccgcgtc
ggattcaccgatgagtttgtggtcgacatggagcataggttcaaatccgcgttcaaggct
atggacgagcttgagaaagggtctatagcgaatccggacgaagggaggatggttggtcac
tactggcttaggaactctagtcttgtcccgaagccgactttgaagacattgattgagaac
actcttgactcgatctgtagtttcgctgatgacataattgctggcaagataaagccaccg
tcttctcctcgttttactcagattctttctgtggggattggtggttcagctcttggtcct
cagtttgttgctgaggccttggctcctgataatcctccattgaagataagattcatagac
aacaccgaccctgctggaatagatcatcagattgcacaacttgggccagagcttgcttca
actttagtaattgttatctcaaagagtggaggcactcctgaaactagaaatggactactg
gaagtacagaaggcattccgagaagctggtctgaacttcgcaaaacagggtgttgcaata
acacaagaaaactcgttgctggataacacggcgagaattgaaggttggttagctaggttt
cctatgtacgactgggtgggtggaagaacatcagttatgtctgcagttggtctccttcca
gctgcacttcagggaattgatattagagagatgcttgctggtgctgcaataatggatgag
gctactaggacaacttcgctcaagaataatcctgcagcgctcttagccatgtgttggtac
tgggcttctgatggcgttggttccaaagatatggtgatccttccttacaaggatagctta
ttgctatttagccggtatctgcagcagttggtcatggaatcactaggaaaggagtttgat
ctcgacggtaacactgttaatcaagggttaactgtatatggaaacaaaggtagcacagat
cagcacgcctacattcaacaactgagggagggtgtgcacaacttctttgcaaccttcata
gaagtgctacgtgacagacccccgggtcatgattgggagcttgagccaggtgtcacttgt
ggtgactacctctttgggatgcttcagggaactagatctgctttatatgcaaacggtaga
gagtccattagtgttaccatcgaggaagtgacaccaagatctgttggggctattatagct
ctctatgaaagagcggtcgggttatatgcctcacttgtcaacataaatgcttaccaccaa
cctggtgtggaagccgggaagaaggcggcagctgaagttctggccctgcaaaagcgtgta
ttgtcagttcttaatgaagccagttgtaaagatccggtagagccattgacactggatgag
atagctgatcgttgccatgctcctgaagaaattgagatgatatacaagatcatagctcac
atgtcagcaaacgacagagttctgatagctgaaggtagctgcggatcgccaaggagtgtt
aaagtgtaccttggtgagtgcaatgtggatgacatgtacgcataa

KEGG   Brassica napus (rape): 106396827Help
Entry
106396827         CDS       T04128                                 

Definition
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic-like
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106396827
   00030 Pentose phosphate pathway
    106396827
   00500 Starch and sucrose metabolism
    106396827
   00520 Amino sugar and nucleotide sugar metabolism
    106396827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106396827
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106396827
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106396827
  Exosomal proteins of other body fluids (saliva and urine)
   106396827
  Exosomal proteins of colorectal cancer cells
   106396827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106396827
NCBI-ProteinID: XP_013692778
AA seq 614 aa AA seqDB search
MASLSTLYSSSPSLKQSTVKAFTSPTTRGDSFSFPHTSKPTTHLPLTLSASRADTSHSDA
AAAAKKELIKDPDALWKRYLDWLYQQKDIGLYLDVSRVGFTDEFVVEMEERFKSAFKAME
ELEKGSIANPDEGRMVGHYWLRNSGLAPRPGLKTLIENTLDSICSFADDIVSGKIKPPSS
TVGRFTQILSVGIGGSALGPQFVAEALAPDNPPLKIMFIDNTDPAGIDHQIAQLGPELAS
TLVIVISKSGGTPETRNGLLEVQKAFRDVGLNFAKQGVAITQENSLLDNTARIEGWLARF
PMYDWVGGRTSVMSAVGLLPAALQGIDIREMLAGAGIMDEATRTTSLKNNPAALLAMCWY
WASDGVGSKDMVILPYKDSLLLFSRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTD
QHAYIQQLREGVHNFFATFIEVLRDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANGR
ESISVTIEEVTPRSVGALIALYERAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRV
LSVLNEASCKDPVEPLTLDEIADRCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSV
EVFLGECNVDDMYA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctctcaaccctctactcttcttctccttctctcaaacagtccaccgttaaa
gcattcacgtctccgacgaccagaggagactccttctctttcccacacacctccaaacca
acaacacacctaccgttgactctctccgcgtcacgcgccgacacttctcactctgatgcc
gccgccgccgccaagaaggagctcatcaaagacccagatgcgctctggaagcgctacctc
gactggctataccagcagaaggacattggactgtaccttgatgtcagccgcgtcgggttc
actgacgagttcgtggtcgaaatggaggagagattcaaatctgcgtttaaggctatggag
gagcttgagaaagggtctatagcgaatccagacgaagggaggatggttggtcattactgg
cttaggaactctggtctcgctcctaggccgggtctaaagacgttgatcgagaacactctt
gattcgatctgtagtttcgctgatgacatagtctctggcaagataaagccaccatcttct
actgtgggtcgttttactcagatactctctgtaggcattggaggctcagctcttggacct
cagtttgttgctgaggccttggctcctgataatcctccgttgaagataatgtttattgac
aacaccgaccctgcgggaatagatcatcagatcgcacaacttgggccagagcttgcctca
actttagtaattgtcatctcaaagagtggaggtactcctgaaactagaaatggactactg
gaagtacagaaagcatttcgtgacgttggtctgaacttcgcaaaacagggtgttgcaata
acacaagagaactcgttgctggataacacggcgagaattgaaggttggttagctaggttt
cctatgtacgactgggtgggtggaagaacatcagtaatgtctgcggttggtctgcttcca
gcagcactacaggggattgatattagagagatgcttgctggtgctgggataatggatgag
gctactaggacaacttctctcaagaataaccctgcagcgctcttagcaatgtgttggtac
tgggcttctgatggcgttggttccaaggatatggttatacttccttacaaggatagctta
ttactatttagccggtatctgcagcagctggtcatggaatctctaggaaaggagtttgat
cttgacggtaacactgttaatcaagggttaactgtatacggaaacaaagggagcacagat
cagcacgcctacattcaacagctgagagagggtgtgcacaatttctttgcaacctttata
gaagtgctacgtgacagacccccaggtcatgattgggatcttgagccaggtgtcacttgt
ggagactacctctttgggatgctacagggaactagatctgctttatatgcaaacggtaga
gagtccattagtgttaccatcgaggaagtgacaccaagatctgttggggctcttatagct
ctttatgaaagagcggtcgggttatatgcctcacttgtcaacataaatgcttaccaccaa
cctggtgtggaagctggtaagaaagcagcagcagaagtactggccttgcaaaagcgtgta
ttgtcagttcttaatgaagccagctgtaaagatccagtagagccattgacactggacgag
atagctgatcgttgccatgctcctgaggaaattgagatgatatacaagatcatagcgcac
atgtctgcaaatgatagagttctaatagctgaaggaagctgcggatcgccaaggagtgtc
gaagtgttcctgggcgagtgcaatgtggatgacatgtacgcatag

KEGG   Brassica napus (rape): 106406319Help
Entry
106406319         CDS       T04128                                 

Definition
(RefSeq) glucose-6-phosphate isomerase, cytosolic
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106406319
   00030 Pentose phosphate pathway
    106406319
   00500 Starch and sucrose metabolism
    106406319
   00520 Amino sugar and nucleotide sugar metabolism
    106406319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106406319
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106406319
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106406319
  Exosomal proteins of other body fluids (saliva and urine)
   106406319
  Exosomal proteins of colorectal cancer cells
   106406319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106406319
NCBI-ProteinID: XP_013702402
AA seq 560 aa AA seqDB search
MTSPTALICETQAWKDLKGHVEDINKTHLRDLMSDAHRCESMMLEFEGLLLDYSRQRATV
ETMDKLLNLAKAAQLSEKISRMFNGEHINSTENRSVLHVALRAPKDAFIKADGKNVVPEV
WNVLDKIKDFSEKIRSGSWVGATGKPLKDVIAIGIGGSFLGPLFVHTALQTDPEAAECAK
GRQLRFLANIDPVDVARNISGLNPETTLVVVVSKTFTTAETMLNARTLRNWITTALGAQA
VAKHMVAVSTNLALVEKFGIDPNNAFAFWDWVGGRYSVCSAVGVLPLSLQYGFSVVEKFL
KGASSIDKHFQSTPFEKNIPVLLGLLSVWNVSFLGYPARAILPYSQALEKFAPHIQQVSM
ESNGKGVSIDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVYL
EGEVVSNHDELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPEL
SAYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGF
NYSTTTLLKRYLETSPEPKM
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaccaacagctctgatttgtgagacccaggcctggaaggatttgaaggggcat
gttgaagatattaacaagactcatttgcgtgatttgatgagtgatgcacacagatgcgag
tccatgatgttggaatttgaggggctcctgttggattattctcgacagcgtgcaactgtg
gagacaatggacaagcttctgaacttggctaaggctgcacagttgtcagagaagatcagc
cgcatgttcaacggtgaacatattaacagtacggagaacaggtcagtgcttcatgttgca
ctccgtgctccaaaggatgcatttattaaggccgatgggaagaatgtggttcctgaagtg
tggaatgttttagacaagatcaaggatttttctgagaaaattcgctctggttcttgggtt
ggagccactggcaaaccgctgaaagatgtcattgcaattggtattggtggtagcttctta
ggtccactttttgtgcacactgctcttcaaacagatcctgaagctgcagagtgtgccaaa
ggacgtcaactgcgtttccttgcaaacattgatcctgttgatgttgctagaaatatcagt
ggactaaatccagaaactaccctagttgtggtggtctcaaaaacgtttactacggctgaa
acaatgctgaacgctaggacgttgaggaattggattacaactgctcttggggctcaggct
gttgcaaaacacatggttgctgtcagcactaatcttgcgttagtggagaagttcggcatt
gatccgaacaatgcatttgcattttgggactgggttggtggaaggtacagtgtttgcagt
gctgttggagtcttaccattgtctctacagtatggcttttctgtggttgagaagttttta
aagggggcttcaagcattgataagcatttccagtccacaccgtttgagaagaatataccc
gtgcttttagggttattgagtgtatggaatgtatcatttcttggatatcctgccagggcc
atcttgccttactcccaagccctagagaaatttgctccgcatattcaacaggttagtatg
gagagtaatggaaagggagtgtcaattgatggtctacctctcccgttcgagactggtgag
attgattttggtgaacctggaacaaatggccaacacagcttttaccaactcattcaccag
ggacgcgtaatcccttgtgatttcattggcactgtgaagagtcagcaacctgtgtacttg
gagggagaggttgtcagtaaccatgacgagcttatgtccaacttttttgctcagcctgat
gctcttgcatatggaaaaacacctgaacagttgcagaaagagaatgtttcagagaatctc
attcctcacaagacattttccggcaaccgaccgtctcttagccttctacttccggaactg
agtgcttacaatgttggccagttgctggcaatctatgaacacagagtggcggttcaaggc
tttgtgtggggtatcaattcgtttgaccagtggggagttgagctaggaaaagttctggct
actcaggtgaggaaacagcttcattcttcccgtactcaaggagctgctcccgaggggttc
aattacagtaccacaacacttttgaaacgttatctcgagacgagtcccgagccgaagatg
tga

KEGG   Brassica napus (rape): 106435192Help
Entry
106435192         CDS       T04128                                 

Definition
(RefSeq) glucose-6-phosphate isomerase, cytosolic-like
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106435192
   00030 Pentose phosphate pathway
    106435192
   00500 Starch and sucrose metabolism
    106435192
   00520 Amino sugar and nucleotide sugar metabolism
    106435192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106435192
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106435192
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106435192
  Exosomal proteins of other body fluids (saliva and urine)
   106435192
  Exosomal proteins of colorectal cancer cells
   106435192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106435192
NCBI-ProteinID: XP_013731512
AA seq 560 aa AA seqDB search
MASPTALISETQAWKDLKGHVEDINKTHLRDLMSDAHRCESMMLEFEGLLLDYSRQRATV
ETMDKLLNLAKAAQLPEKISRMFNGEHINSTENRSVLHVALRAPKDAVIKADGKNVVPEV
WNVLDKIKDFSDKIRSGSWVGATGKPLKDVIAIGIGGSFLGPLFVHTALQTDPESAECAK
GRQLRFLANIDPVDVARNISGLNPETTLVVVVSKTFTTAETMLNARTLRNWITTALGAPA
VAKHMVAVSTNLALVEKLGIDPNNAFAFWDWVGGRYSVCSAVGVLPLSLQYGFSVVEKFL
KGASSIDQHFQSTPFEKNIPVILGLLSVWNVSFLGYPARAILPYSQALEKFAPHIQQVSM
ESNGKGVSIDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVYL
EGEVVSNHDELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPEL
SAYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGF
NYSTTTLLKRYLETSPEPKM
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaccaacagctctgatttctgagacccaggcctggaaggatttgaaggggcat
gttgaagatattaacaagactcatttgcgtgatttgatgagtgatgcacacagatgcgag
tccatgatgttggaatttgaggggctgctgttggattattctcgacagcgtgcaactgtg
gagacaatggacaagcttctgaacttggctaaggctgcacagttgccagagaagatcagc
cgcatgttcaatggggagcatattaacagtacggagaacaggtcagtgcttcatgttgca
ctccgtgctccaaaggatgcagttattaaggccgatgggaagaatgtggttcctgaagtg
tggaatgttttagacaagatcaaggatttttctgataaaattcgctctggttcatgggtt
ggagccactggcaaaccgctgaaagatgtcattgctattggtattgggggtagcttctta
ggtccactttttgtgcacacggctcttcaaacagatcctgaatctgcagagtgtgccaaa
ggacgtcaactgcgtttccttgcaaacattgaccctgttgatgttgctagaaatatcagt
ggactaaatccagaaactaccctagttgtggtggtctcaaaaacgtttactacggctgaa
acaatgctgaacgctaggacattgaggaattggattacaactgctcttggggctccggct
gttgcaaaacacatggttgctgtcagcactaatcttgcgttagtggagaagttaggcatt
gatccgaacaatgcatttgcattttgggactgggttggtggaaggtacagtgtttgcagt
gctgttggagtcttaccattgtctctacagtatggcttctccgtggttgagaagttttta
aagggagcttcaagcattgatcagcatttccagtccacaccgtttgagaagaatataccc
gtgattttagggttattgagtgtatggaatgtatcatttcttggatatcctgccagggcc
atcttaccttactcccaagcccttgagaaatttgctccgcatattcaacaggttagtatg
gagagtaatggaaaaggagtgtcaattgatggtctacctctcccgttcgagactggtgag
attgattttggtgaacctggaacaaatggccaacacagcttttaccaactcattcaccag
ggacgcgtaatcccttgtgatttcattggcactgtgaagagtcagcaacctgtgtacttg
gagggagaggttgtcagtaaccatgacgagcttatgtccaacttttttgctcagcctgat
gctcttgcatatggaaaaacacctgaacagctgcagaaagagaatgtttcagagaatctc
attcctcacaagacattctccggcaaccgaccgtctcttagcctcctacttccggaactg
agtgcttacaatgttggccagttgctggcaatctatgaacacagagtggcggttcaaggc
tttgtgtggggtatcaattcgtttgaccagtggggagttgagctaggaaaagttctggct
actcaggtgaggaaacagcttcattcgtcacgtactcaaggagctgctcccgagggattc
aattacagtaccacaacacttttgaaacgatatctcgagacaagtcccgagccgaagatg
tga

KEGG   Brassica napus (rape): 106440787Help
Entry
106440787         CDS       T04128                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucose-6-phosphate isomerase 1, chloroplastic-like
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106440787
   00030 Pentose phosphate pathway
    106440787
   00500 Starch and sucrose metabolism
    106440787
   00520 Amino sugar and nucleotide sugar metabolism
    106440787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106440787
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106440787
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106440787
  Exosomal proteins of other body fluids (saliva and urine)
   106440787
  Exosomal proteins of colorectal cancer cells
   106440787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106440787
NCBI-ProteinID: XP_013737975
AA seq 609 aa AA seqDB search
MASLSGLFSSSLKPSKTLSVKALSAPPTRGGDSFSFPHTSKPTHLPLTLSASRSDISHTD
AASKKELIKDPDALWKRYLDWLYQQKDLGLYLDVSRVGFTDEFVVDMEHRFKAAFKAMDE
LEKGSIANPDEGRMVGHYWLRNSSLVPKPTLKTLIENTLDSICSFADDIIAGKIKPPSSP
RFTQILSVGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQIAQLGPELASTLV
IVISKSGGTPETRNGLLEVQKAFREAGLNFAKQGVAITQENSLLDNTARIEGWLARFPMY
DWVGGRTSVMSAVGLLPAALQGIDIREMLSGAAIMDEATRTTSLKNNPAALLAMCWYWAS
DGVGSKDMVILPYKDSLLLFSRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHA
YIQQLREGVPNFFATFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESI
SVTIEEVTPRSVGAIIAXGAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLN
EASCKDPVEPLTLDEIADRCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVYLG
ECNVDDMYA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctctcaggcctcttctcttcctctctcaaaccatccaaaaccctctccgtc
aaagcattgtcggcgccgccgacaagaggaggagactccttctctttcccacacacctcc
aaacccacccacctaccgttgactctctccgcttctcgctccgacatttctcacacggac
gccgcctccaagaaagagcttatcaaagatccagatgcgctctggaagcggtacctagat
tggctgtaccagcagaaggacctcgggctgtatctcgacgtcagccgcgtcggattcacc
gatgagtttgtggtcgacatggagcataggttcaaagccgcgttcaaggccatggatgag
cttgagaaagggtctatagcgaatccagacgaagggaggatggttggacactactggctt
aggaactctagtcttgtcccaaagcctactttgaagacgttgattgagaacactcttgac
tcgatctgtagtttcgctgacgatataattgctggcaagatcaagccaccgtcttctcct
cgttttactcagattctttctgtggggattggtggttcagctcttggtcctcagtttgtt
gctgaggccttggctcctgataatcctccattgaagataagattcattgacaacaccgac
cctgctggaatagatcatcagattgcacagcttgggccagagcttgcctcaactttagta
attgttatctcaaagagtggaggcactcctgaaactagaaatggactactggaagtacag
aaggcgttccgagaagctggtctgaacttcgcaaaacagggtgttgcaataacacaagaa
aactcgttgctggataacacggcgagaattgaaggttggttagctaggtttcctatgtac
gactgggtgggtggaagaacatctgttatgtctgcagttggtctccttccagctgcactt
cagggaattgatattagagagatgctttctggtgctgcaataatggatgaggctactagg
acaacttcgctcaagaataatcctgcagcgctcttagccatgtgttggtactgggcttct
gatggcgttggttccaaagatatggtgatccttccttacaaggatagcttattgctattt
agccggtatctgcagcagttggtcatggaatcactaggaaaggagtttgatcttgacggt
aacactgttaatcaagggttaactgtatatggaaacaaagggagcacagatcagcacgcc
tacattcaacaactgagggagggtgtgcccaacttctttgcaaccttcatagaggtgcta
cgtgacagacctccaggtcatgattgggagcttgagccaggtgtcacttgtggagactac
ctctttgggatgcttcagggaactagatctgctttatatgcaaacggtagagagtccatt
agtgttaccatcgaggaagtgacaccaagatctgttggggctattatagctncaggagcg
gttgggttgtatgcctcacttgtcaatattaatgcttaccaccaacctggtgtggaagcc
gggaagaaggcggcagctgaagtgcttgcacttcaaaagcgtgtattgtcagttcttaat
gaagccagttgtaaagatccggtagagccattgacactggatgagatagctgatcgttgc
catgctcctgaagaaattgagatgatatacaagatcatagctcacatgtctgcaaacgac
agagttctgatagctgaaggtagctgcgggtcgccaaggagtgttaaagtgtaccttggc
gagtgcaatgtggatgacatgtacgcataa

KEGG   Brassica napus (rape): 106442156Help
Entry
106442156         CDS       T04128                                 

Definition
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic-like
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106442156
   00030 Pentose phosphate pathway
    106442156
   00500 Starch and sucrose metabolism
    106442156
   00520 Amino sugar and nucleotide sugar metabolism
    106442156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106442156
Enzymes [BR:bna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     106442156
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106442156
  Exosomal proteins of other body fluids (saliva and urine)
   106442156
  Exosomal proteins of colorectal cancer cells
   106442156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 106442156
NCBI-ProteinID: XP_013739335
AA seq 616 aa AA seqDB search
MASLSTLYSSSPSLKQSTVKAFTSPPTTRGDSFSFPHTSKPTTHLPLTLSASRSHTSHSD
AAAAAAKKELIKDPDALWKRYLDWLYQQKDIGLYLDVSRVGFTDEFVVDMEERFQGAFKA
MEELEKGSIANPDEGRMVGHYWLRNSSLAPRPALKTLIENTLDSICSFADEIVSGKIKPP
SSPAGRFTQILSVGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQIAQLGPEL
ASTLVIVISKSGGTPETRNGLLEVQKAFRDAGLNFAKQGVAITQENSLLDNTARIEGWLA
RFPMYDWVGGRTSVMSAVGLLPAALQGIDIREMLAGAAIMDEATRTNSLKNNPAALLAMC
WYWASDGVGSKDMVILPYKDSLLLFSRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGS
TDQHAYIQQLREGVHNFFATFIEVLRDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYAN
GRESISVTIEEVTPRSVGALIALYERAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQK
RVLSVLNEASCKDPVEPLTLDEIADRCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPR
SVKVFLGECNVDDMYA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctctcaaccctctactcttcttctccttctctcaaacagtccaccgttaaa
gcattcacgtctcctccgacgaccagaggagactccttctctttcccacacacctccaaa
ccaacaacacacctaccgttgactctctccgcgtcacgctcccacacttctcactctgat
gccgccgccgccgcagccaagaaggagcttatcaaagaccccgatgcgctctggaagcgc
tacctcgactggctataccagcagaaggacattggactgtacctcgatgtcagccgcgtc
gggttcactgacgagttcgtggtcgatatggaggagagattccaaggtgcgtttaaggct
atggaggagcttgagaaagggtctatagcgaatccagacgaagggaggatggttggtcat
tactggcttaggaactctagtctcgctcctaggccggctttaaagacgttgatcgagaac
actcttgattctatctgcagtttcgctgatgaaatagtctctggcaagataaagccacca
tcttctcctgcgggtcgttttactcagatactctctgtaggcattggaggctctgctctt
gggcctcagtttgttgctgaagctttagctcctgataatcctccgttgaagataaggttt
attgacaacaccgaccctgcgggaatagatcatcagatcgcacaacttgggccggagctt
gcctcaactttagtaattgtcatctcaaagagtggaggtactcctgaaactaggaatgga
ctattggaagtacagaaagcatttcgtgacgctggtctgaacttcgcaaaacagggtgtt
gcaataacacaagagaactcgttgctggataacacggcgagaattgaaggttggttagct
agatttcctatgtacgactgggtgggtggaagaacatcagtaatgtctgcggttggtctg
cttccagcagcactacaggggattgatattagagagatgcttgctggtgctgctataatg
gatgaggctactaggacaaattctctcaagaataaccctgcagcgcttttagcaatgtgt
tggtactgggcttctgacggtgttggttccaaggatatggttatccttccttacaaggat
agtttattactatttagccggtatctgcagcagctggtcatggaatcactaggaaaggag
tttgatcttgacggtaacactgttaatcaagggttaactgtatatggaaacaaaggcagc
actgatcagcacgcctacattcaacagctgagagagggtgtgcacaatttctttgcaacc
tttatagaagtgctacgtgacagacccccaggtcatgattgggatcttgagccaggtgtc
acttgtggagactacctctttgggatgctacagggaactagatctgctttatatgcaaac
ggtagagagtccattagtgttactatcgaggaagtgacaccaagatctgttggggctctt
atagctctttacgaaagagcagtcgggttatatgcctcacttgtgaacattaatgcttac
caccaacccggtgtggaagccggtaaaaaggcagcagcagaagtactggccttgcaaaag
cgtgtgttgtcagttcttaatgaagccagctgtaaagatccagtagagccattgacactg
gacgagatagctgatcgttgccatgctcctgaggaaatcgagatgatatacaagatcata
gcgcacatgtctgcaaatgatagagttctaatagctgaaggaagctgcggatcgccaagg
agtgtcaaagtgttcctgggcgagtgcaatgtggatgacatgtacgcatag

DBGET integrated database retrieval system