KEGG   Brassica napus (rape): 106349038Help
Entry
106349038         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 2-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106349038
   00520 Amino sugar and nucleotide sugar metabolism
    106349038
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106349038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA KR
Motif
Other DBs
NCBI-GeneID: 106349038
NCBI-ProteinID: XP_013644370
AA seq 360 aa AA seqDB search
MASENNGSTAAETPRKVALVTGITGQDGSYLTELLLEKGYEVHGLIRRSSNFNTQRINHI
YIDPHNANKALMKLHYADLSDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADVV
ATGALRLLEAVRSHTVDSGRTVKYYQAGSSEMFGATPPPQSETTPFHPRSPYAASKVAAH
WYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQASR
DWGFAGDYVEAMWLMLQQEKADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDERYF
RPAEVDNLKGDASKAKEVLGWKPKVGFEKLVKMMVDEDLEIAKREKLLVDAGHMDAQQQP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaaaacaacggatccaccgccgcggaaacgccgaggaaggtagcactcgtc
accggaatcaccggccaagacggatcgtacctgacggagctcctcctcgagaaaggctac
gaagtccacggcctgatccgccgatcatcgaacttcaacacccagcggatcaaccacatc
tacatcgacccgcacaacgccaacaaagccctcatgaagctccactacgccgacctctcc
gacgcatcctccctccgtcgctggctcgacgtgatcaaacccgacgaagtctacaacctc
gccgcgcagtctcacgtcgccgtctccttcgagatccctgattacaccgccgacgtcgtc
gccaccggcgctctccgcctcctcgaagccgtcagatctcacaccgtcgacagcggtcgt
accgtcaagtactaccaagccgggtcttccgagatgttcggtgcaactccaccaccgcag
tccgaaacgacgccgtttcatccgaggtctccctacgccgcgtcgaaagtcgctgcgcat
tggtacactgtgaactaccgtgaggcttacggtctttttgcctgtaacgggatcttgttc
aaccacgagtccccgcgccgcggagagaacttcgtgacgaggaagataacgagagccttg
gggaggatcaaggtgggtttgcagaggaagctctttctcgggaatctccaggcgtcgaga
gactgggggttcgcgggggattatgttgaagcgatgtggctgatgctgcagcaagagaag
gcggatgattacgttgtggccacggaggagtcgcataccgtggaggagtttcttgaggtt
tcgtttgggtacttggggctgaactggaaggatcatgtggagattgacgagaggtacttc
aggcctgctgaagttgataatcttaaaggagatgctagcaaggctaaggaggtgttgggg
tggaagcccaaagttgggtttgagaagctggtgaagatgatggttgatgaagatcttgag
attgctaagagggagaagttgcttgttgatgctggtcacatggatgctcagcagcaacct
tga

KEGG   Brassica napus (rape): 106358475Help
Entry
106358475         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 1-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106358475
   00520 Amino sugar and nucleotide sugar metabolism
    106358475
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106358475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA KR NAD_binding_4
Motif
Other DBs
NCBI-GeneID: 106358475
NCBI-ProteinID: XP_013653740
AA seq 368 aa AA seqDB search
MASQDNVSRSEAPNASDSHIALTKVALVTGITGQDGSYLTEFLLQKGYEVHGLIRRSSNY
NTQRINHIYVDPHNANKARMKLHYADLSDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEI
PDYTADVVATGALRLLEAVRSHMADNGRNIKYYQAGSSEMFGSTPPPQSETTPFHPRSPY
AASKCAAHWYTVNYREAYGLYACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLF
LGNIQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEESHTVEEFLEVSFGYLGLSWKDH
VEIDKRYFRPTEVDNLKGDASKAKEALKWKPKVGFEQLVKMMVDEDLEMAKREKVLVDAG
YIDAQQQP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccaagacaatgtgtccagatccgaagctcctaatgccagtgattctcacatt
gcgctgactaaggttgcacttgtcaccgggatcaccggtcaggacggatcatacctgacg
gagttcctgctccaaaaaggctacgaggtccacggcctgatccgacgatcctcaaattac
aacactcagcgtatcaaccatatctacgtcgatccccacaacgccaacaaagctcgcatg
aagctccactacgctgatctctctgatgcctcctccctccgccgttggctcgacgtcatc
aagcctgacgaggtctacaaccttgctgctcagtcccacgttgctgtctcctttgagatc
cctgactacactgctgatgtcgttgctacgggagctctccgcctcctggaggctgtgagg
tctcacatggctgacaatggccgtaacatcaagtactaccaggccggatcctcggagatg
ttcgggtcaactcctcctccgcaatctgagacgacgccgtttcacccgagatctccttac
gctgcctccaaatgcgctgctcattggtacacagtcaactaccgagaagcatacggcctg
tacgcctgcaacgggatcctattcaaccacgagtcaccccgccgaggcgagaacttcgtg
actaggaaaataaccagggccctggggaggatcaaggtcggactacagaccaagctcttc
ctgggaaacatacaggcgtcaagggactgggggttcgcgggggactacgtggaggcaatg
tggctgatgctgcagcaggagaaaccagatgactacgtggtggcaactgaggagtctcac
acggtcgaggagtttctggaagtgtccttcgggtacctcgggctcagctggaaagaccac
gtggagatagacaagaggtacttcaggccaacggaggttgacaatctgaaaggcgacgcg
agcaaggcgaaggaagcgttgaagtggaagcccaaagtagggttcgagcagctggtgaag
atgatggtggacgaagatctggagatggctaagagggagaaagtgctcgttgatgctggt
tacattgacgctcagcagcaaccttaa

KEGG   Brassica napus (rape): 106359921Help
Entry
106359921         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 2-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106359921
   00520 Amino sugar and nucleotide sugar metabolism
    106359921
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106359921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA KR
Motif
Other DBs
NCBI-GeneID: 106359921
NCBI-ProteinID: XP_013655028
AA seq 360 aa AA seqDB search
MASENNEARSEEMRRKIALVTGITGQDGSYLTEFLLEKGYEVHGLIRRSSNFNTQRINHI
YIDPHNADKALMKLHYADLSDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVV
ATGALRLLEAVRSHTVDSGRTVKYYQAGSSEMFGATPPPQAETTPFHPRSPYAASKVAAH
WYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQASR
DWGFAGDYVEAMWMMLQQDKADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDKRYF
RPSEVDNLKGDASKAKEVLGWKPKVGFEKLVKMMVDEDLALAKREKVLVDAGYMDAQQQP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgaaaacaacgaagccagatccgaggaaatgcggaggaagatagcactggtc
accgggatcaccggccaagacggatcgtacctgacggagttcctcctcgagaaaggctac
gaagtccacggcctgatccgccgatcgtcgaacttcaacacgcagcggatcaaccacatc
tacatcgacccgcacaacgccgacaaggctctgatgaagctccactacgccgatctctcc
gacgcgtcctccctccgccgctggatcgacgtgatcaagcccgacgaagtgtacaacctc
gccgcgcagtctcacgtcgccgtctccttcgagatccctgactacaccgccgacgtggtc
gccaccggcgctctccgcctcctagaagccgtcagatctcacacggtggacagcggtcgc
accgtcaagtactaccaggcgggatcttccgagatgttcggagcgactccgcctccgcag
gccgaaacgacgccgtttcaccccagatctccttacgccgcgtcaaaagtcgctgcgcat
tggtacaccgttaactaccgcgaggcctacggtctcttcgcgtgtaacgggatcttgttc
aaccacgagtctccgcgccgcggagagaacttcgtgacgaggaagatcacgagagccttg
gggaggatcaaggtcggcttgcagaggaagctcttcctcgggaacctccaggcttctcga
gactgggggttcgcgggggactacgtggaggccatgtggatgatgctgcagcaggataag
gcggatgattacgtcgtggccacggaggagtcgcatacggttgaggagtttctcgaggtt
tcgtttgggtacttggggcttaactggaaggatcatgtggagattgataagaggtacttt
aggccctctgaagttgataacttgaaaggagatgcgagcaaggccaaggaagtcttgggt
tggaagccgaaagtgggctttgagaagctcgtgaagatgatggttgatgaagatcttgcc
cttgctaagagggagaaagttcttgttgatgctggttacatggatgctcagcagcagcct
tga

KEGG   Brassica napus (rape): 106361857Help
Entry
106361857         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 1-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106361857
   00520 Amino sugar and nucleotide sugar metabolism
    106361857
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106361857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 106361857
NCBI-ProteinID: XP_013657120
AA seq 379 aa AA seqDB search
MASENNGSRSNVEMPRKIALVTGITGQDGSYLTEFLLSKGYEVHGLIRRSSNFNTQRINH
IYIDPHNADKALMKLHYADLTDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADV
VATGALRLLEAVRSHTADTGRTVKYYQAGSSEMFGATPPPQSETTPFHPRSPYAASKVAA
HWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQAS
RDWGFAGDYVEAMWMMLQQEAADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDKRY
FRPSEVDNLKGDASKAKQVLGWKPKVGFEKLVKMMVDEDLELAKREKVLVDAGYMDAQQQ
PYQLQHPADQPHLHRPAQR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaaaacaacggatccagatccaatgtggaaatgccgagaaagatagctctc
gtcaccggaatcaccggccaagacggatcgtacctgacggagttcctcctctcaaaaggc
tacgaagtccacggcctgatccgccgatcatccaacttcaacacccagcggatcaaccac
atctacatcgacccgcacaacgctgacaaggctctgatgaagctccactacgccgatctc
accgacgcctcctcgctccgccgctggctcgacgtgatcaagcccgacgaggtctacaac
ctcgccgcgcagtcccacgtcgccgtctccttcgagatccccgattacaccgccgacgtc
gtcgccaccggcgccctccgcctcctcgaggccgtcagatctcacaccgccgacaccggc
cgcaccgtcaagtactaccaggcgggatcctccgagatgttcggagcgactccgcctcct
cagtccgaaacgacgccgtttcaccccaggtccccttacgcagcgtccaaagtcgctgcg
cattggtacactgttaactaccgtgaggcgtacggtctcttcgcgtgcaacgggatcttg
ttcaaccacgagtcgcctcgccgcggagagaacttcgtgacgaggaagatcacgagagcc
ttggggaggatcaaggtgggtttgcagaggaagctcttcctcgggaacctacaagcttcg
agggactgggggttcgcgggggactacgtggaggcgatgtggatgatgctgcagcaggag
gcggcggatgattacgttgtggcgacggaggagtcgcatacggttgaggagtttctcgag
gtttcgtttgggtacttggggctgaactggaaggatcacgtggagattgataagaggtac
tttaggccgtctgaagtggataacttgaaaggagatgctagcaaggccaagcaagtgttg
gggtggaaacccaaagtggggtttgagaagcttgtgaagatgatggttgatgaagacctt
gagcttgctaagagggagaaagtgcttgttgatgctggttacatggatgctcagcagcaa
ccttaccaacttcaacacccagcggatcaaccacatctacatcgacccgcacaacgctga

KEGG   Brassica napus (rape): 106367717Help
Entry
106367717         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 2-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106367717
   00520 Amino sugar and nucleotide sugar metabolism
    106367717
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106367717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA KR
Motif
Other DBs
NCBI-GeneID: 106367717
NCBI-ProteinID: XP_013662999
AA seq 360 aa AA seqDB search
MASENNEARSEEMRRKIALVTGITGQDGSYLTEFLLEKGYEVHGLIRRSSNFNTQRINHI
YIDPHNADKALMKLHYADLSDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVV
ATGALRLLEAVRSHTVDSGRTVKYYQAGSSEMFGATPPPQAETTPFHPRSPYAASKVAAH
WYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQASR
DWGFAGDYVEAMWMMLQQDKADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDKRYF
RPSEVDNLKGDASKAKEVLGWKPKVGFEKLVKMMVDEDLALAKREKVLVDAGYMDAQQQP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgaaaacaacgaagccagatccgaggaaatgcggaggaagatagcactggtc
accgggatcaccggccaagacggatcgtacctgacggagttcctcctcgagaaaggctac
gaagtccacggcctgatccgccgatcgtcgaacttcaacacgcagcggatcaaccacatc
tacatcgacccgcacaacgccgacaaggctctgatgaagctccactacgccgatctctcc
gacgcgtcctccctccgccgctggatcgacgtgatcaagcccgacgaagtgtacaacctc
gccgcgcagtctcacgtcgccgtctccttcgagatccctgactacaccgccgacgtggtc
gccaccggcgctctccgcctcctagaagccgtcagatctcacacggtggacagcggtcgc
accgtcaagtactaccaggcgggatcttccgagatgttcggagcgactccgcctccgcag
gccgaaacgacgccgtttcaccccagatctccttacgccgcgtcaaaagtcgctgcgcat
tggtacaccgttaactaccgcgaggcctacggtctcttcgcgtgtaacgggatcttgttc
aaccacgagtctccgcgccgcggagagaacttcgtgacgaggaagatcacgagagccttg
gggaggatcaaggtcggcttgcagaggaagctcttcctcgggaacctccaggcttctcga
gactgggggttcgcgggggactacgtggaggccatgtggatgatgctgcagcaggataag
gcggatgattacgtcgtggccacggaggagtcgcatacggttgaggagtttctcgaggtt
tcgtttgggtacttggggcttaactggaaggatcatgtggagattgataagaggtacttt
aggccctctgaagttgataacttgaaaggagatgcgagcaaggccaaggaagtcttgggt
tggaagccgaaagtgggctttgagaagctcgtgaagatgatggttgatgaagatcttgcc
cttgctaagagggagaaagttcttgttgatgctggttacatggatgctcagcagcagcct
tga

KEGG   Brassica napus (rape): 106405977Help
Entry
106405977         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 1-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106405977
   00520 Amino sugar and nucleotide sugar metabolism
    106405977
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106405977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 106405977
NCBI-ProteinID: XP_013702003
AA seq 355 aa AA seqDB search
MATPIASEPRKVALVTGITGQDGSYLTEFLLGKGYQVHGLIRRSSNYNTQRINHIYVDPH
NATKALMKLHYADLSDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGAL
RLLEALRSHMADNGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKVAAHWYTVN
YREAYGLYACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNIQASRDWGFA
GDYVEAMWLMLQQEKPDDYVVATEESHTVEEFLDVSFGYLGLNWKDHVEIDKRYFRPTEV
DNLKGDASKAKELLKWKPKVGFEQLVKMMVDEDLETAKREKVLVDAGYIDAQQQP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccactcccattgcgtcggagccaaggaaggttgcgttggtcaccgggatcactgga
caggacggatcatacctgacggagttcctgctcggaaaagggtaccaagtgcacggcctg
atccgacgatcctcaaactacaacacgcagcgaatcaaccatatctacgtggatccccac
aatgccaccaaagccctcatgaagctccactacgccgatctctctgatgcctcctccctc
cgccgttggctcgacgtcatcaagcccgacgaggtctacaaccttgctgctcagtcccac
gtcgccgtctccttcgagatccctgactacactgctgacgtggtcgctactggagctctc
cgcctcctggaggctctcaggtctcacatggctgacaatggccgcaccgtcaagtactac
caggccggatcctcggagatgttcgggtcaactcctcctccgcagtctgagacgacgccg
tttcacccgagatctccctatgctgcctccaaagtcgcggctcactggtacaccgtcaat
tacagagaagcatacggcctgtacgcctgcaacgggatcctgttcaaccacgagtcaccc
cgccgaggcgagaacttcgtgactcggaagataacacgggccttggggaggatcaaggtc
gggctgcagacgaagctcttcctcgggaacatacaggcctccagagactgggggttcgca
ggggactacgtggaggcaatgtggctgatgctgcagcaggagaaaccagatgactatgtg
gtggctactgaggagtcgcacaccgtcgaggagtttctggacgtctccttcgggtacctc
ggcctcaactggaaagaccacgtggagatagacaagaggtacttcaggcctacggaggtt
gacaatctcaaaggagatgcgagcaaggcaaaggagttgttgaagtggaagcccaaggtt
gggttcgagcagctggtcaagatgatggtggatgaagatctggagacggctaagagggag
aaagtgctcgtcgatgctggttacattgacgctcagcagcaaccttaa

KEGG   Brassica napus (rape): 106416511Help
Entry
106416511         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 1-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106416511
   00520 Amino sugar and nucleotide sugar metabolism
    106416511
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106416511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 106416511
NCBI-ProteinID: XP_013712904
AA seq 361 aa AA seqDB search
MATPNGNDSHIASEPRKVALVTGITGQDGSYLTEFLLGKGYEVHGLIRRSSNYNTQRINH
IYVDPHNANKALMKLHYADLSDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADV
VATGALRLLEAVRSHMADNGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKVAA
HWYTVNYREAYGLYACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNIQAS
RDWGFAGDYVEAMWLMLQQEKPDDYVVATEESHTVEEFLDVSFGYLGLNWKDHVEIDKRY
FRPTEVDNLKGDASKAKELLKWKPKVGFEQLVKMMVDEDLETAKREKVLVDAGYIDAQQQ
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggccactcctaatggcaacgattctcacattgcgtcggagccaaggaaggttgcattg
gtcaccgggatcactgggcaggacggatcatacctgacggagttcctgctcggaaaaggg
tacgaagtgcacggcctgatccgacgatcctcaaactacaacacgcagcgaatcaaccat
atctacgtggatccacacaatgccaacaaagctctcatgaagctccactacgctgatctc
tctgatgcctcctccctccgccgttggctcgacgtcatcaagcctgacgaggtctacaac
cttgctgctcagtcccacgtcgctgtctccttcgagatccctgactacactgctgatgtg
gtcgcgactggagctctccgcctcctggaggctgtcaggtctcacatggctgacaatggc
cgcaccgtcaagtactaccaggccggatcctcggagatgttcgggtcaactcctcctccc
caatctgagacgacgccgtttcacccgagatctccctatgctgcctccaaagtcgcagct
cactggtacaccgtcaattacagagaagcatacggcctgtacgcctgcaacgggatcctg
ttcaaccacgagtcaccccgcagaggcgagaacttcgtgactcggaagataacacgggcc
ttggggaggatcaaggtcggactgcagacgaagctcttcctggggaacatacaggcctca
agagactgggggttcgcaggggactacgtggaggcaatgtggctgatgctgcagcaggag
aaaccagatgactatgtggtggctactgaggagtcgcacaccgtcgaggagtttctggac
gtgtccttcgggtacctcggcctcaactggaaagaccacgtggagatagacaagaggtac
ttcaggccaacggaggttgacaatctgaaaggagatgcgagcaaggcaaaggagttgttg
aagtggaagcccaaggttgggttcgagcagctggtgaagatgatggtggatgaagatctg
gagacggctaagagggagaaagtgctcgtcgatgctggttacattgacgctcagcagcaa
ccttaa

KEGG   Brassica napus (rape): 106421899Help
Entry
106421899         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 2
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106421899
   00520 Amino sugar and nucleotide sugar metabolism
    106421899
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106421899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 106421899
NCBI-ProteinID: XP_013718190
UniProt: A0A078H797
AA seq 360 aa AA seqDB search
MASENNGSTAVETPRKVALVTGITGQDGSYLTELLLSKGYEVHGLIRRSSNFNTQRINHI
YIDPHNANKALMKLHYADLSDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADVV
ATGALRLLEAVRSHTVDSGRTVKYYQAGSSEMFGATPPPQSETTPFHPRSPYAASKVAAH
WYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQASR
DWGFAGDYVEAMWLMLQQEKADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDQRYF
RPAEVDNLKGDASKAKEVLGWKPKVGFEKLVKMMVDEDLEIAKREKLLVDAGHMDAQQQP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagagaacaacggatccaccgccgtggaaacgcctcggaaggtagcactcgtc
accggaatcaccggccaagacggatcgtacctgacggagctcctcctctcaaaagggtac
gaagtccacggcctgatccgccgatcgtcgaacttcaacacccagcggatcaaccacatc
tacatcgacccgcacaacgccaacaaagccctcatgaagctccactacgccgacctctcc
gacgcctcctccctccgccgctggctcgacgtcatcaaacccgacgaagtctacaacctc
gccgcgcagtctcacgtcgccgtctccttcgagatccctgattacaccgccgacgtcgtc
gccaccggcgctctccgcctcctcgaagccgtcagatctcacaccgtcgacagcggccgt
accgtcaagtactaccaagccgggtcttcggagatgttcggtgcaactccgccaccgcag
tccgaaacgacgccgtttcatccgaggtctccttacgcagcgtccaaagtcgctgcgcat
tggtacacggtgaactaccgtgaggcttacggtctttttgcgtgtaacgggatcttgttc
aaccacgagtccccgcgccggggagagaacttcgtgacgaggaagataacgagagccttg
gggaggatcaaggtgggtttgcagaggaagctctttctagggaacctccaggcgtcgaga
gactgggggttcgcgggggattacgtggaggcgatgtggctgatgctgcagcaagagaag
gcggatgattacgttgtggcgacggaggagtcgcatacggtggaggagtttcttgaggtt
tcgtttgggtacttggggctgaactggaaggatcatgtggagattgatcagaggtacttt
aggcctgctgaagttgataaccttaaaggagatgctagcaaggccaaggaggtgttgggc
tggaagcctaaagttgggtttgagaagctggtgaagatgatggttgatgaagatcttgag
attgctaagagggagaagttgcttgtggatgctggtcacatggatgctcagcagcaacct
tga

KEGG   Brassica napus (rape): 106440111Help
Entry
106440111         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 1-like
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106440111
   00520 Amino sugar and nucleotide sugar metabolism
    106440111
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106440111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NmrA KR
Motif
Other DBs
NCBI-GeneID: 106440111
NCBI-ProteinID: XP_013737156
AA seq 373 aa AA seqDB search
MGHRDIQIQKPSMASENNGSRSDVEMPRKIALVTGITGQDGSYLTEFLLEKGYEVHGLIR
RSSNFNTQRINHIYIDPHNADKALMKLHYADLTDASSLRRWLDVIKPDEVYNLAAQAHVA
VSFEIPDYTADVVATGALRLLEAVRSHTADTGRTVKYYQAGSSEMFGATPPPQSETTPFH
PRSPYAASKVAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGL
QRKLFLGNLQASRDWGFAGDYVEAMWLMLQQEEADDYVVATEESHTVEEFLEVSFGYLGL
NWKDHVEIDKRYFRPSEVDNLKGDASKAKEVLGWKPKVGFEKLVKMMVDEDLELAKREKV
LVDAGYMDAQQQP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggccaccgcgatatccagatccaaaaaccatcaatggcgtcagaaaacaacggatcc
agatccgatgtggaaatgccgaggaagatagcactggtcaccggaatcaccggccaagac
ggatcgtacctgacggagttcctcctcgagaaaggctacgaagtccacggcctgatccgc
cgatcgtccaacttcaacacccagcggatcaaccacatctacatcgacccgcacaacgcc
gacaaggctctgatgaagctccactacgccgatctcaccgacgcgtcctcgctccgccgc
tggctcgacgtgatcaagcccgacgaggtctacaacctcgccgctcaggcccacgtcgcc
gtctccttcgagatccccgattacacggccgacgtcgtcgccaccggcgccctccgcctc
ctcgaagccgtcagatctcacaccgccgacaccggccgcacggtcaagtactaccaggcc
ggatcctccgagatgttcggagcgaccccgcctccgcagtcggaaacgacgccgtttcac
cccaggtccccctacgcagcgtccaaagtcgctgcgcattggtacactgttaactaccgt
gaggcctacggtctcttcgcgtgcaacgggatcttgttcaaccacgagtcgccacgtcgc
ggagagaacttcgtgacgaggaagataacgagagcgttggggaggatcaaggtcggtttg
cagaggaagctcttcctcgggaacctacaagcttcccgggactgggggttcgctggggac
tacgtggaggcgatgtggctgatgctgcagcaggaggaggcggatgattacgtcgtggcg
acggaggagtcgcatacggtggaggagtttctcgaggtttcgtttgggtacttggggctg
aactggaaggatcacgtggagattgataagaggtactttaggccgtctgaagtggataac
ttgaaaggagatgctagcaaggccaaggaagtgttggggtggaaacccaaagtggggttt
gagaagctggtgaagatgatggttgatgaagaccttgagcttgctaagagggagaaagtg
cttgttgatgctggttacatggatgctcagcagcaaccttga

KEGG   Brassica napus (rape): 106448174Help
Entry
106448174         CDS       T04128                                 

Definition
(RefSeq) GDP-mannose 4,6 dehydratase 2
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
bna  Brassica napus (rape)
Pathway
bna00051  Fructose and mannose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106448174
   00520 Amino sugar and nucleotide sugar metabolism
    106448174
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     106448174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 106448174
NCBI-ProteinID: XP_013745556
AA seq 289 aa AA seqDB search
MKLHYADLTDASSLRRWLDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAV
RSHTADTGRTVKYYQAGSSEMFGATPPPQSETTPFHPRSPYAASKVAAHWYTVNYREAYG
LFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQRKLFLGNLQASRDWGFAGDYVEA
MWMMLQQEAADDYVVATEESHTVEEFLEVSFGYLGLNWKDHVEIDKRYFRPSEVDNLKGD
ASKAKQVLGWKPKVGFEKLVKMMVDEDLELAKREKVLVDAGYMDAQQQP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccactacgccgatctcaccgacgcctcctcgctccgccgctggctcgacgtg
atcaagcccgacgaggtctacaacctcgccgcgcagtcccacgtcgccgtctccttcgag
atccccgattacaccgccgacgtcgtcgccaccggcgccctccgcctcctcgaggccgtc
agatctcacaccgccgacaccggccgcaccgtcaagtactaccaggcgggatcctccgag
atgttcggagcgactccgcctcctcagtccgaaacgacgccgtttcaccccaggtcccct
tacgcagcgtccaaagtcgctgcgcattggtacactgttaactaccgtgaggcgtacggt
ctcttcgcgtgcaacgggatcttgttcaaccacgagtcgcctcgccgcggagagaacttc
gtgacgaggaagatcacgagagccttggggaggatcaaggtgggtttgcagaggaagctc
ttcctcgggaacctacaagcttcgagggactgggggttcgcgggggactacgtggaggcg
atgtggatgatgctgcagcaggaggcggcggatgattacgttgtggcgacggaggagtcg
catacggttgaggagtttctcgaggtttcgtttgggtacttggggctgaactggaaggat
cacgtggagattgataagaggtactttaggccgtctgaagtggataacttgaaaggagat
gccagcaaggccaagcaagtgttggggtggaaacccaaagtggggtttgagaagcttgtg
aagatgatggttgatgaagatcttgagcttgctaagagggagaaagtgcttgttgatgct
ggttacatggatgctcagcagcaaccttag

DBGET integrated database retrieval system