KEGG   Brassica napus (rape): 106349212Help
Entry
106349212         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 3
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106349212
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106349212
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106349212
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106349212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 106349212
NCBI-ProteinID: XP_013644597
AA seq 486 aa AA seqDB search
MAVQPTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFH
DPESFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAV
SENGFLYLGMGVSGGEEGARNGPSMMPGGSFEAYKNIEDILLKVAAQVRDSGPCVTYIGK
GGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHGVFTEWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKD
ERVQAAKVFKEGGFGDVLTDQTVDKKQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGW
GLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVC
LSINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaaccaactagaataggcttagctggactagccgtaatgggccagaactta
gctctcaacattgcttccaaaggcttcccaatctccgtctacaacagaacaacctccaaa
gtcgacgagaccgtggaacgagccaagaaagaaggaaacctccccgtctacggcttccac
gaccccgagtccttcgtcaactccatccaaaagccacgtgtcataatcatgctcgtcaaa
gccggtgcacccgtcgaccaaaccatcaaaaccctctcagcttacctagaaaaaggcgat
tgcatcgtcgacggtggtaacgaatggtacgagaacacagagaggagagaaaaagccgtg
tccgagaacggcttcctctacctaggaatgggagtctccggcggcgaagaaggtgctcgt
aacggtccgtctatgatgcctggagggtcctttgaagcttacaagaatatcgaagacatt
cttctcaaggttgcggctcaggttagagacagtggtccctgtgtgacttacatcggtaaa
ggaggctctggaaacttcgtcaaaatggtccataacgggattgagtacggtgacatgcag
ctgattgctgaagcctatgatgttcttaagtccgttggtaagctatctaacgaagagctt
cacggggtcttcactgagtggaacaaaggtgagctcgagagtttcttggtagagatcact
gcggatatttttgggatcaaggacgataagggtgatgggcatttggttgataaggttttg
gacaaaaccgggatgaaaggtaccgggaaatggactgtgcagcaagcagccgagctctct
gttccttctcccaccattgaatcctctctcgacgcgaggttcctcagcgggcttaaggac
gagcgtgtgcaggccgctaaggtcttcaaggaaggtggttttggcgatgtattaaccgac
caaaccgttgacaagaagcagctgatagacgacgtgaggaaggctctctacgcctccaaa
atctgcagctacgcacaagggatgaacctgatccgcgccaagagcgtggaaaaggggtgg
ggtttgaagctaggtgagctggctaggatctggaaaggagggtgcatcatcagagcaatc
ttcttggacaggatcaagcaagcttacgacaggaacgcggagctggctaacctcttggtg
gatcctgagtttgcgaaagagatcatcgagaggcagtcggcttggaggagagtggtctgc
ttgagcatcaactcgggtattagcacgcctggtatgtctgcgagtctggcgtactttgat
tcttacaggagagagaggttgccggcgaaccttgtacaagctcagagagattactttggt
gctcatacctatgaaaggactgatgtggaagggtctttccacaccgagtggttcaagatt
gcaagacaatccaagatgtaa

KEGG   Brassica napus (rape): 106352176Help
Entry
106352176         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 3-like
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106352176
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106352176
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106352176
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106352176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 106352176
NCBI-ProteinID: XP_013647304
AA seq 486 aa AA seqDB search
MAVQPTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFH
DPESFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAV
SENGFLYLGMGVSGGEEGARNGPSMMPGGSFEAYKNIEDILLKVAAQVRDSGPCVTYIGK
GGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLTNEELHGVFTEWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKD
ERVQAAKVFKEGGFGDVLTDQTVDKKQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGW
GLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVC
LSINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDMEGSFHTEWFKI
ARQSKM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaaccaactagaataggcttagctggactagccgtaatgggccaaaactta
gctctcaacattgcttccaaaggcttcccaatctccgtctacaacagaacaacctccaaa
gtcgacgaaaccgtcgaacgagccaagaaagaaggaaacctccctgtctacggcttccac
gaccccgagtccttcgtcaactccatccaaaagccacgtgtcataatcatgctcgtcaag
gccggtgcacccgtcgaccaaaccatcaagaccctctcagcttatctagaaaaaggtgat
tgcatagtcgacggcggcaacgaatggtacgagaacacagagaggagagaaaaagccgtg
tccgagaacggcttcctctacctaggaatgggagtctctggtggtgaagaaggtgctcgt
aacggcccctcaatgatgcctggaggatcctttgaggcttacaagaacatcgaagacatt
cttctcaaggttgcggctcaggtcagggacagtggtccatgtgtgacgtacatagggaaa
ggagggtctggaaacttcgtcaaaatggttcacaatgggattgagtacggtgacatgcag
ctgattgctgaagcctatgatgtgttgaaatccgttggtaagctaacgaacgaggagctt
cacggtgtcttcaccgagtggaacaaaggcgagctcgagagtttcttggtagagatcact
gcggatatctttgggattaaggacgataagggtgatgggcatttggttgataaggttttg
gacaaaactgggatgaaaggtaccgggaaatggaccgtgcagcaagcagctgagctctct
gttccttctcccactatagaatcctctcttgacgcgaggttcctcagcgggcttaaggac
gagcgtgtgcaggccgctaaggtcttcaaggaaggtggttttggcgatgtcttaaccgat
caaaccgttgacaagaagcagctgatagatgacgtgaggaaggctctgtacgcttcgaaa
atctgcagctacgcgcaaggaatgaacctgatccgcgccaagagcgtggaaaagggatgg
gggttgaagctaggtgagctggctaggatctggaaaggagggtgcatcatcagagccatc
ttcttggacaggatcaagcaagcttacgacaggaacgcagagctggctaacctcttggtg
gatcccgagtttgcgaaagagatcatcgagaggcagtcggcttggaggagagtggtctgc
ttgagtatcaactcgggtattagcactcccggtatgtctgcgagtctggcgtactttgat
tcttacaggagagagaggttgccggcgaaccttgtccaagctcagagagattactttggt
gctcatacttatgaaaggactgatatggaagggtctttccacactgagtggttcaagatt
gcaagacaatccaagatgtaa

KEGG   Brassica napus (rape): 106382867Help
Entry
106382867         CDS       T04128                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, decarboxylating 3
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106382867
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106382867
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106382867
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106382867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 106382867
NCBI-ProteinID: XP_022575672
AA seq 488 aa AA seqDB search
MAVQPTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFH
DPESFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAV
SENGFLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILLKVAAQVRDSGPCVTYIGK
GGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLTNEELHSVFTEWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGXKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKD
ERVQAAKVFKEGGFGDVLTDQTVDKKQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGW
GLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVC
LSINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKSNM
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaaccaacaagaataggtttagctggactagctgtgatgggacagaaccta
gctctcaacattgcttccaaaggcttcccaatctccgtctacaacagaacaacttccaaa
gtcgacgaaaccgtcgaacgagccaagaaagaaggaaacctcccggtctacggcttccac
gaccccgagtccttcgtcaactccattcaaaaaccacgtgtcataatcatgctcgtcaaa
gctggtgcacccgtcgaccagaccatcaagaccctctcagcttatctcgaaaaaggtgac
tgcatcgtcgacggtggcaacgagtggtacgagaacaccgagaggagagaaaaagctgtg
tctgagaacggtttcctctacctaggaatgggagtctcaggcggcgaagaaggtgctcgt
aacggcccatctctgatgcctggagggtcctttgaagcgtacaagaacatcgaagacatt
ctcctcaaggttgcggctcaggttagagacagtggtccttgcgtgacatacattggcaaa
ggtggctctggaaactttgtcaaaatggttcacaacgggatcgagtacggtgacatgcag
ctgattgctgaagcctatgatgtcttgaaatccgttggtaagttaacgaacgaggagctt
catagtgtattcaccgagtggaacaaaggcgagctcgagagtttcttggtggagatcaca
gcggatatcttcgggatcaaggacgataagggagatgggcatttggttgacaaggttttg
gacaaaaccggantgaaaggtaccgggaaatggacggtgcagcaagcagccgagctctct
gttccttctcccaccattgaatcctctctcgacgcgaggttcctcagcgggctaaaggat
gagcgtgtgcaagccgctaaggtctttaaagaaggtggttttggcgatgtattaaccgac
caaaccgttgacaagaagcagctcatcgacgacgtgaggaaggctctctacgcgtcgaaa
atctgcagctacgcgcaagggatgaacctaatccgcgccaagagcatggagaaagggtgg
ggccttaagctaggcgagctggcgaggatctggaaaggagggtgcatcatcagagcgatc
tttttagacaggatcaagcaagcttacgacaggaacgcggagctggctaacctcttggtg
gatcccgagtttgcgaaagagatcatcgagaggcagtcggcttggaggagagtggtctgc
ttgagtatcaactcgggtatcagcactcccggtatgtctgcgagtctggcgtactttgat
tcttacaggagagagaggctgccggcgaaccttgtgcaagctcagagagattactttggt
gctcatacttatgagaggactgatgttgaaggctctttccacaccgagtggttcaagatc
gcaagacaatccaaatccaacatgtga

KEGG   Brassica napus (rape): 106389066Help
Entry
106389066         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic-like
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106389066
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106389066
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106389066
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106389066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 106389066
NCBI-ProteinID: XP_013684706
AA seq 487 aa AA seqDB search
MESAALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQ
YSPRDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVE
AEKKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFTEWNRGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQSAVFSVAAPTFAASLDCRYLSGLKD
ERENAAKVLKEAGLKEDIGSASHGIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEK
EWNLNLGEMARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRV
VGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT
KLARKGN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgctctctcccgcattggtctcgccggcctcgccgtcatgggccaaaac
ctcgccctgaacatcgccgacaaaggcttccccatctcggtctacaaccgaaccacctcc
aaagtcgacgaaaccctagatcgcgcctccgaagaaggcaagctcccagtctccggccaa
tactcccctcgcgacttcgtcctctccatccagcgccccagatccgtcatcatcctcgtc
aaagccggcgcccccgttgaccagaccatctccgccctctccgagtacatggagcccggt
gactgcatcatcgacggcggtaacgagtggtaccagaacacagagcgacgaatcgttgaa
gctgagaagaaaggattgctctacttggggatgggagtctccggaggcgaggaaggggct
cgtaacggcccctccctcatgcctggaggttctttccaggcctataacaacgttaaagac
attctcgagaaagtcgccgctcaggtggaggacggtccctgcgtgacttatataggagaa
ggcggatctgggaacttcgtgaaaatggttcataatgggatcgagtacggtgacatgcag
ctcatttccgaggcgtacgatgttttgaagaacgttggggggttaagcaatgacgagctt
gcggagatttttacagagtggaaccgaggtgagctggagagtttcttggttgagattact
tcggatatttttagggttaaggatgagtttggggatggagagttagtggataagattttg
gataagactggtatgaagggtaccgggaaatggactgttcagcagtctgctgtgttctca
gtggcggcgccgactttcgctgcctcgttggattgtaggtacttgagtggactcaaggac
gagagggagaatgctgccaaagtgttgaaggaagctgggttgaaggaggatattggttct
gcatctcatgggattgataaaaagaggttgattgatgatgtgaggcaagctttgtacgct
tctaagatctgtagttatgctcaagggatgaatttgcttagagctaagagtgtggagaag
gagtggaacttgaatctcggcgagatggctcggatttggaaaggagggtgtattatcagg
gcggtgttcttggacaggatcaagaaagcttaccagaggaacccgaacctggcgagtttg
gtggttgatcctgatttcgctaaagagatggttcagaggcaagctgcgtggaggagagtc
gtgggtttggccatctctgcgggaataagcacgccgggaatgtgcgcgagtcttgcctac
ttcgacacttacaggcgtgcgagattgcctgcgaatctggttcaggcgcagagagatctc
tttggagctcatacgtatgagaggaccgatcgtcctggtgcgtaccacacggaatggact
aagcttgctaggaaggggaattag

KEGG   Brassica napus (rape): 106389242Help
Entry
106389242         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106389242
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106389242
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106389242
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106389242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 106389242
NCBI-ProteinID: XP_013684903
AA seq 487 aa AA seqDB search
MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ
YSPRDFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCIIDGGNEWYQNTERRISE
AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNRGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQRAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLREAGLKEEIGSASSGIDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK
SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV
VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRSGAYHTEWT
KLARKSN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgctctctcccgaatcggcctcgccggtctcgccgtaatgggccagaac
ctcgccttgaacatcgccgagaaaggcttcccaatctccgtctacaaccgaaccacatct
aaagtcgacgaaaccctagatcgcgccgccgtcgaaggaaacctcccggtctccggccaa
tactccccgcgcgacttcgtcctctcgctccaacgccctcgttccctcatcatcctcgtc
aaagccggagcccccgtcgaccagaccatcgccgccttctccgagtacatggagcccgga
gactgcatcatcgacggaggaaacgagtggtaccagaacacagagcggcggatctccgaa
gctgagcagaaaggattgctctacttaggcatgggagtctccggcggagaagaaggggct
cgtaacggtccctcgctgatgccaggaggttcgtttcaggcctacgataacatcaaagac
atcttggggaaagtcgcggctcaggtcgaggacgggccttgcgtcacttacatcggtgaa
ggcggatctgggaacttcgtgaagatggttcacaacgggattgagtatggagatatgcag
cttatctctgaggcttacgacgtgttgaagaacgttggtggattgagcaacgaggagctt
gcggagatcttcacggagtggaaccgaggtgagctcgagagtttcttggttgagattact
tccgatatctttagggttaaggatgagtttggtgatggagagttggtggataagattttg
gataagactggtatgaaagggaccgggaaatggactgttcagcgggcggcggagctctct
gtggcggcgccgaccattgctgcttcgttggactgtcggtacttgagcgggttgaaagat
gagagggagaatgctgctaaagtgttgagagaagctgggttgaaggaagagattggttct
gcgtcgagcgggatcgataagaagaggttggttgatgatgttagacaagctctatacgct
tcgaagatatgtagttacgctcaagggatgaatctgcttagagctaagagcttagagaag
agctggaacttgaactttggtgagttggctaggatttggaaaggagggtgtatcataagg
gcggtgttcttggataggatcaagaaagcttaccagaggaacccggatttggcgagcctt
gtggttgatcctgagttcgctaaagagatggttcagagacaagctgcttggaggagagtg
gtgggtttggctgtctctgctgggataagcacccctggaatgtgcgcgagtcttgcgtat
ttcgatacttataggcgtgcgagattaccggcgaatctggttcaggcgcagagagatctc
tttggagctcatacttacgagaggactgatcgttctggtgcgtaccacacggagtggact
aagcttgctaggaagagcaattga

KEGG   Brassica napus (rape): 106446298Help
Entry
106446298         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106446298
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106446298
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106446298
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106446298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 106446298
NCBI-ProteinID: XP_013743450
UniProt: A0A078I347
AA seq 487 aa AA seqDB search
MESAALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQ
YSPRDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVE
AEKKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFTEWNRGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLKEAGLKEDIGSASHGIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEK
EWNLNLGEMARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRV
VGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT
KLARKGN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgctctctcccgcattggtctcgccggcctcgccgtcatgggccaaaac
ctcgccctgaacatcgccgacaaaggcttccccatctcggtctacaaccgaaccacctcc
aaagtcgacgaaaccctagatcgcgcctccgaagaaggcaagctcccagtctccggccaa
tactcccctcgcgacttcgtcctctccatccagcgccccagatccgtcatcatcctcgtc
aaagccggcgcccccgttgaccagaccatctccgccctctccgagtacatggagcccggt
gactgcatcatcgacggcggtaacgagtggtaccagaacacagagcgacgaatcgttgaa
gctgagaagaaaggattgctctacttggggatgggagtctccggaggcgaggaaggggct
cgtaacggcccctccctcatgcctggaggttctttccaggcctataacaacgttaaagac
attctcgagaaagtcgccgctcaggtggaggacggtccctgcgtgacttatataggagaa
ggcggatctgggaacttcgtgaaaatggttcataatgggatcgagtacggtgacatgcag
ctcatttccgaggcgtacgatgttttgaagaacgttggggggttaagcaatgacgagctt
gcggagatttttacagagtggaaccgaggtgagctggagagtttcttggttgagattact
tcggatatttttagggttaaggatgagtttggggatggagagttagttgataagattttg
gataagacgggaatgaaaggaaccgggaaatggactgttcagcaggcggctgagctctca
gtggcggcgccgactatcgctgcctcgttggattgtaggtacttgagtggactcaaggac
gagagggagaatgctgccaaagtgttgaaggaagctgggttgaaggaggatattggttct
gcatctcatgggattgataaaaagaggttgattgatgatgtgaggcaagctttgtacgct
tctaagatctgtagttatgctcaagggatgaatttgcttagagctaagagtgtggagaag
gagtggaacttgaatctcggcgagatggctcggatttggaaaggagggtgtattatcagg
gcggtgttcttggacaggatcaagaaagcttaccagaggaacccgaacctggcgagtttg
gtggttgatcctgatttcgctaaagagatggttcagaggcaagctgcgtggaggagagtc
gtgggtttggccatctctgcgggaataagcacgccgggaatgtgcgcgagtcttgcctac
ttcgacacttacaggcgtgcgagattgcctgcgaatctggttcaggcgcagagagatctc
tttggagctcatacgtatgagaggaccgatcgtcctggtgcgtaccacacggaatggact
aagcttgctaggaaggggaattag

KEGG   Brassica napus (rape): 106446309Help
Entry
106446309         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic isoform X1
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106446309
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106446309
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106446309
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106446309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 106446309
NCBI-ProteinID: XP_013743461
AA seq 497 aa AA seqDB search
MESAALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQ
YSPRDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVE
AEKKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFTEWNRGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQXXXXXXXXXXQAAELSVAAPTIAASL
DCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGIDKKRLIDDVRQALYASKICSYAQGM
NLLRAKSVEKEWGLNLGEMARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPDFAKEM
VQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTD
RPGAYHTEWTKLARKGN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgctctctcccgcatcggcctcgccggcctcgccgtcatgggccaaaac
ctcgccctgaacatcgccgacaaaggcttccccatctccgtctacaaccgaaccacctcc
aaagtcgacgaaaccctagatcgcgcctccgaggaaggcaagctcccagtctccggccaa
tactcccctcgcgacttcgtcctctccatccagcgccccagatccgtcatcatcctcgtc
aaagccggcgcccccgttgaccagaccatctccgccctctccgagtacatggagccaggg
gactgcatcatcgacggcggaaacgaatggtaccagaacacagagcgacgaatcgttgaa
gctgagaagaaaggattgctctacttggggatgggagtctccggaggcgaggaaggggct
cgtaacggcccctccctcatgcctggaggttctttccaggcgtataacaatgttaaagac
attctcgagaaagtcgccgctcaggtggaggatggcccttgcgtgacttatataggagaa
ggcggatctgggaacttcgtgaagatggttcataatgggatcgagtacggtgatatgcag
ctcatttccgaggcttacgatgttttgaagaacgttgggggattaagcaatgatgagctg
gcggagatttttacagagtggaaccgaggtgagctggagagtttcttggttgagattact
tcggatatttttagggttaaggatgagtttggggatggagagttagtggataagattttg
gataagactggtatgaagggtaccgggaaatggactgttcagcnnnnnnnnnnnnnnnnn
nnnnnnnnnnngcaggcggctgagctatcagtggcggcgccgactattgctgcttcgttg
gattgtagatacttgagtgggctcaaggacgagagggagaatgcagccaaagtgttggag
gaagctggattgaaggaggatattggttctgcgtctcgtgggattgataagaagaggttg
attgatgatgtgaggcaagctttgtacgcgtctaagatctgtagttatgctcaagggatg
aatttgcttagagctaagagtgtggagaaggagtggggcttgaatcttggtgagatggct
cggatttggaaaggagggtgtattatcagggcggtgttcttggacaggatcaagaaagct
taccagaggaacccgaatcttgcgagtttggtggttgatcctgatttcgctaaagagatg
gttcagaggcaggcggcgtggaggagagtcgtgggtttggccatctctgcggggataagc
acgcctggaatgtgcgcgagtcttgcctacttcgacacttacaggcgtgcgagactgcct
gcgaatctggttcaggcgcagagagatctctttggagctcatacgtatgagaggaccgat
cgtcctggtgcgtaccacacggaatggactaagcttgctaggaaggggaattag

KEGG   Brassica napus (rape): 106452617Help
Entry
106452617         CDS       T04128                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic-like
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bna  Brassica napus (rape)
Pathway
bna00030  Pentose phosphate pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bna_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106452617
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106452617
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106452617
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106452617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 106452617
NCBI-ProteinID: XP_013750233
AA seq 487 aa AA seqDB search
MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ
YSPRDFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCIIDGGNEWYQNTERRISE
AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNRGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQRAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLREAGLKEEIGSASSGVDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK
SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV
VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRSGAYHTEWT
KLARKSN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgctctctcccgcatcggcctcgccggtctcgccgtaatgggccagaac
ctcgccttgaacatagccgagaaaggcttcccaatctccgtctacaaccgaaccacatcc
aaagtcgacgagaccctagatcgcgccgccgtcgaaggaaacctcccggtctccggccaa
tactccccgcgcgacttcgtcctctctctccaacgccctcgttccctcatcatcctcgtc
aaagccggagcccccgtcgaccagaccatcgctgccttctccgagtacatggagcccgga
gactgcatcatcgacggaggaaacgagtggtaccagaacacagagcgacggatctccgaa
gctgagcagaaaggattgctctacttggggatgggagtctccggcggcgaggaaggggct
cgtaacggtccctcgctgatgccaggagggtcgtttcaggcgtatgataacatcaaagac
atcttggggaaagtcgcggctcaggttgaggacgggccttgcgtcacttacatcggtgaa
ggcggatctgggaacttcgtgaagatggttcataatgggattgagtatggagatatgcag
cttatctctgaggcttacgacgtgttgaagaacgttggcgggttgagcaacgaggagctt
gcggagatcttcacggagtggaaccgaggtgagctcgagagcttcttggttgagattact
tccgatatctttagggttaaggatgagtttggtgatggagagttggtggataagattttg
gataagactggtatgaaagggaccgggaaatggactgttcagcgggcggcggagctctct
gtggcggcgccgaccattgctgcttcgttggactgtcggtacttgagcgggttgaaagat
gagagggagaatgctgctaaagtgttgagagaagctgggttgaaggaagagattggttct
gcgtcgagcggggtcgataagaagaggttggttgatgatgttagacaagctctctacgct
tcgaagatatgtagttacgctcaagggatgaatctgcttagagctaagagcttagagaag
agctggaacttgaacttcggtgagttggctaggatttggaaaggagggtgtatcataagg
gcggtgttcttggataggatcaagaaagcttaccagaggaacccggatttggcgagcctt
gtggttgatcctgagtttgctaaagagatggttcagagacaagctgcttggaggagagtc
gtgggtttggctgtctctgctgggattagcacccctggaatgtgcgcaagtcttgcgtat
ttcgatacttataggcgtgcgagactgccggcgaatctggtgcaggcgcagagagatctc
tttggagctcatacttacgagagaactgatcgttctggtgcgtaccacacggagtggact
aagcttgctaggaagagcaattga

DBGET integrated database retrieval system