KEGG   Brassica napus (rape): 106349331Help
Entry
106349331         CDS       T04128                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106349331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106349331
Enzymes [BR:bna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106349331
Spliceosome [BR:bna03041]
 Complex C
  Other components
   Step II factors
    106349331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA DUF2075 Sigma54_activ_2 AAA_16 PhoH ABC_tran Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 106349331
NCBI-ProteinID: XP_013644733
AA seq 1171 aa AA seqDB search
MEKKELNKLNHLSLVSNICNELETHLGQAPKDLAEYIIHLGRNSETADELDKKLKKDGAE
LPDYFVRSLLTVIHGIYPPQPKSDDVEEDGGEKERFKGLAIRDTKDKVKELEKEIEREAQ
ERQREEDRNRRGSGRDRDRDDRRDRYGDGDDRRSDRHRGRYDEGDRHRGRDRGDDRGGRH
RGRSRGDDEGGEGRSDRRRDRGVQDEYTGANEPELYQVYKGRVTRVMDSGCFVQFDRFRG
KEGLVHVSQMATRRVDRAESVVKRDMEVYVKVVSIKEGGKYSLSMKDVDQNTGRDLIPLK
KPSDDDDLGRSNPSYRTKDGQVTKTGISGIRIVEESNVAPSRRPLKKMSSPERWEAKQLI
AAGALKASEFPDYDEDGDGMLYQEEGAEEELEIEMNEEEPAFLQGQTRYSVDMSPVKIFK
NPEGSLSRAAALQSALTKERREMREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELR
GVGLSAYDMPEWKKDAFGKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVHDNQVLVVI
GETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIR
FEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKLLKR
RLDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQI
HLTEPEGDILLFLTGQEEIDSACQSLYERMKNLGKNVPELIILPVYSALPSEMQSRIFDP
PPPGTRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQR
AGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMD
PPQPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILT
MIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFI
QSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFFHGARKDPQEGYRTL
VENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVADPT
HMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaggagctgaacaagctaaaccatctctctctcgtctccaacatctgcaac
gaattggagacgcatctaggtcaagcgccgaaggatctggccgagtacatcatccatctc
ggccgcaactccgaaaccgccgacgaactcgacaagaagctgaagaaggacggcgcggag
cttcctgattatttcgtccgctcgctgttaaccgtaatccacgggatctaccctccgcag
cccaagtccgacgatgtagaagaagatggcggcgaaaaagagagattcaaaggcttggcg
attagggatactaaggataaggtcaaggagctcgagaaggagattgagagggaggctcag
gagaggcagagagaggaggatcggaatcggagaggttccggtagggatagggatcgagat
gatagaagggatcggtatggagatggtgatgatagaagaagtgataggcataggggaaga
tatgatgaaggtgataggcataggggaagagaccgtggagatgatagaggtggtaggcat
agggggagatcacgtggcgatgatgaaggaggagagggaagaagtgataggcgtagagat
cgtggtgtgcaggatgagtacactggtgcgaatgagcctgagttgtatcaggtatacaaa
ggtagagtgactagggtgatggactctggctgctttgttcagtttgataggtttagaggg
aaagaaggtttagtccatgtttctcagatggctactagaagggttgatagggctgagagt
gtggtgaagcgggatatggaagtttatgttaaagttgtatctattaaagagggtggtaag
tatagtctttctatgaaggacgttgatcagaacacggggagagacttgatcccgctgaag
aagccttcagatgatgatgatttagggaggagtaatccgtcgtatagaacaaaggatggg
caagtcaccaagactgggatttcagggattcggattgttgaggagagtaatgtcgcgcct
tcacgtaggccactgaagaagatgagctcccctgagagatgggaagcgaagcagctcatt
gctgctggtgctttgaaagcgagtgagtttcctgattacgatgaggatggagatgggatg
ctttatcaagaggaaggtgctgaagaagagcttgagattgagatgaatgaagaagaacct
gccttcttacaagggcagactaggtactctgttgacatgtctcctgttaagatcttcaaa
aatccagaaggttccttgagtcgtgctgctgcgcttcagtctgcgctcaccaaggagagg
agggaaatgagggaacagcagcagagaacgatgcttgactccatccctaaggatctgaat
cgtccttgggaagatcctatgcctgaaactggtgaaagacatcttgctcaggagcttaga
ggtgtcggtttatctgcttatgacatgcctgagtggaagaaggatgctttcggtaaaact
ccaacttttggacaaagatcaaagctttctatccaggagcaaagggagagtcttcctata
tacaagctgaaaaaggagctaatacaggctgtgcacgacaaccaagttttggtggtcatt
ggtgagactgggtcagggaagacaacacaggttactcagtatcttgcagaagcaggttac
acaactaaaggaaagattggatgtactcagcctcgtagagtcgctgcaatgtctgttgca
aagagagtagctgaggagtttggttgtcgtttgggagaggaagtaggatatgcaattcgg
tttgaagattgtacgggaccagatacagtgatcaagtacatgactgatggtatgcttcta
agggagattctgattgatgaaaacctctctcagtactctgttataatgcttgatgaagct
catgagcggacaattcacactgatgtgttgtttggtcttctaaagaagctgttgaaacgc
aggcttgaccttcgtctgattgtcacatccgccacactggatgcagagaaattctctggg
tatttcttcaactgcaacatctttacaatccctggaagaacctttcctgtagagattctg
tataccaaacagccagaaagcgattacctggatgcagctctgatcacagttcttcagatt
cacttgactgagccagagggtgatattcttctcttcttgacgggacaggaagaaatcgat
tctgcgtgccagtctctctacgagaggatgaaaaatctaggtaaaaacgttcctgaactc
atcatacttcctgtttacagtgccctccctagtgaaatgcagtctagaatatttgatcct
cctcctcctggtacccggaaagtggttgtagctacaaatattgcagaagcctctttgacg
atagatggaatttattatgttgttgatcctgggtttgcaaagcagaacgtgtacaatcca
aagcaaggactagagtcgcttgtcatcactccaatctcacaggcatcggcgaagcagagg
gctggacgtgctggtcgtactggtcccgggaaatgttaccgtctctacacagagagcgca
taccgtaatgagatgcctcctacatcaatccctgaaatccagaggattaaccttggaatg
acaaccctgaccatgaaagcaatgggcattaatgacctgttgtcgtttgatttcatggat
ccaccccaaccgcaagcgttgatctctgctatggaacagttgtacagcttgggagctttg
gatgaggaaggactgttgacaaagctaggtagaaaaatggctgagtttcctcttgagcca
ccgctctctaagatgttgctagcgagtgttgatcttgggtgcagcgatgagattttaacg
atgattgctatgatccagacgggaaacatattttatagaccgagggagaagcaagctcaa
gcagaccagaagagggcaaagtttttccagcctgaaggtgaccacttgacattgctagct
gtatatgaagcttggaaagctaagaacttctcaggtccatggtgttttgagaacttcata
cagtcaagatcactacgacgtgctcaagacgtgaggaaacagcttctcagcattatggac
aaatataaactagacgtggtgagtgcgggaaagaacttcacgaagataaggaaagcgatc
acagcaggattcttcttccatggagcaagaaaagatccgcaggaaggttacaggacgctt
gtggagaatcaaccggtttacatacatccgagcagtgcattgttccagagacaaccagat
tgggtgatatatcacgatcttgtgatgacgaccaaggagtacatgcgagaagtgaccgtg
attgacccgaagtggcttgttgagctagctccaaggtttttcaaagtggctgatccaacc
catatgagcaagcgtaagcgccaggaacgcatagagcctttgtatgatcgttatcacgag
cccaactcatggcgtctcagtaagagacgtgcttga

DBGET integrated database retrieval system