KEGG   Brassica napus (rape): 106349490Help
Entry
106349490         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106349490
   00030 Pentose phosphate pathway
    106349490
   00051 Fructose and mannose metabolism
    106349490
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106349490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106349490
   03036 Chromosome and associated proteins [BR:bna03036]
    106349490
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106349490
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106349490
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106349490
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106349490
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106349490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106349490
NCBI-ProteinID: XP_013644914
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQRVLFRQPSSAAVVLRNRATYLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLTRAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcttctccagtgttggacaaatctgagtgggtcaag
ggccaacgcgttctcttccgtcagccttcttccgccgccgtcgtcctacgcaaccgcgcc
acctaccttaccgtccgcgccgcttcttcctacgccgatgagctcgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgccacatgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcataccggaca
ctgcttgtctctgcaccaggtctcggacagtacatctccggtgcaatcctgttcgaggag
actctctatcagtctaccaccgaaggcaagaaaatggtcgacgtcctagtcgagcagaac
atcgtccccggtatcaaagtcgacaagggtttggtgccacttgttggatctaacaatgag
tcatggtgccaaggacttgacggtctatcctctcggaccgctgcttactaccaacagggt
gctcgtttcgccaaatggcgtactgtggtgagcattcccaacggtccgtctgctctcgct
gtgaaagaagctgcttggggccttgctcgatacgctgccatttcacaagacagtggattg
gttcccatagtggagccagagatcttgttggatggagaacacgacattgacaggacttac
gaagtagctgagaaggtgtgggctgaggttttcttttacctagctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactccaggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaagctcctccgcaacagaatccctcct
gccgtccctggaatcatgttcttgtccggaggacagtctgagttggaggcaacgttgaac
ctgaacgcgatgaaccaggcaccaaacccgtggcacgtgtccttctcctacgcacgtgct
cttcagaacacttgcctgaaaacatggggaggcagagctgagaacgtgaacgcagctcag
accactctcttgactcgagccaaggccaattcgttggctcagctcggaaaatacaccgga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctactga

KEGG   Brassica napus (rape): 106358261Help
Entry
106358261         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106358261
   00030 Pentose phosphate pathway
    106358261
   00051 Fructose and mannose metabolism
    106358261
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106358261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106358261
   03036 Chromosome and associated proteins [BR:bna03036]
    106358261
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106358261
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106358261
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106358261
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106358261
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106358261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106358261
NCBI-ProteinID: XP_013653463
AA seq 344 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAAVLRNRATSLAVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSKILSIGHI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctcctgtattggacaaatcggagtgggtcaag
ggacaaagcgttctcttccgtcagccatcttccgccgccgccgtcctacgtaaccgcgcc
acctcccttgccgtccgtgccgcttcatcctacgcggatgagcttgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacatgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcatacaggaca
ttgctggtctctgcaccaggactcggacagtacatctccggtgcaatcttgttcgaggag
actctgtatcagtctaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcagaac
atcgtccccggtatcaaagtcgacaagggtttggtcccacttgttggatctaacaatgag
tcatggtgccaagggctcgatggtctatcctcccgaaccgctgcttactatcaacagggt
gctcgtttcgccaaatggcgtactgtggtgagcattcccaacggtccgtctgctctagct
gttaaagaagctgcttgggggcttgctcgatacgctgccatttcacaggacagtggattg
gttccaatagtggagccagagatcttgttggacggagaacacgacattgacaggacttac
gaagtagcagagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaaactcctccgcaacagaatccctccg
gccgtccccggaatcatgttcttgtccggaggacagtccgagttggaggcaacgttgaat
ctgaacgcgatgaaccaagcaccaaacccgtggcatgtttccttctcaaaaatattatct
attgggcatatttag

KEGG   Brassica napus (rape): 106361479Help
Entry
106361479         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106361479
   00030 Pentose phosphate pathway
    106361479
   00051 Fructose and mannose metabolism
    106361479
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106361479
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106361479
   03036 Chromosome and associated proteins [BR:bna03036]
    106361479
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106361479
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106361479
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106361479
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106361479
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106361479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106361479
NCBI-ProteinID: XP_013656679
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSASVVLPNRATSLAVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctccagtgttggacaaatctgagtgggtcaag
ggccaaagcgttctcttccgtcagccttcttccgcctccgtcgtcctccccaaccgcgcc
acctccctcgccgtccgtgccgcttcttcctacgccgatgagcttgtcaagacagcgaaa
acaattgcgtctcccggacgtggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcgtacaggaca
ttgcttgtctctgcaccaggtctcggacagtacatctccggggcaatattgttcgaggag
actctctatcagtctaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcagaac
atcgtccccggtatcaaagttgacaagggtttggtgccacttgttggctctaacaatgag
tcatggtgtcaaggactcgatggtctatcctctcgcactgctgcttactaccaacagggt
gctcgtttcgctaaatggcgtactgtcgtgagcattcccaacggcccgtctgctctcgct
gtgaaagaagctgcttggggccttgctcgctacgctgccatttcacaggacagtggattg
gtcccaattgtggagccagagatcttgttggacggagaacacgacattgacaggacttac
gaagtagctgagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgctgcctacacccttaagctcctccgcaacagaatccctcca
gccgtccccggaatcatgttcttgtccggaggacagtctgagttggaggcaacgttgaac
ctcaacgcgatgaaccaggcaccaaacccatggcacgtgtccttctcctacgcacgtgct
ctccagaacacttgtctgaaaacatggggaggcagagctgagaacgtgaacgctgctcag
accactctcttggctcgtgccaaggccaactcgttggctcagcttggaaaatacaccgga
gaaggcgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattaa

KEGG   Brassica napus (rape): 106367801Help
Entry
106367801         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106367801
   00030 Pentose phosphate pathway
    106367801
   00051 Fructose and mannose metabolism
    106367801
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106367801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106367801
   03036 Chromosome and associated proteins [BR:bna03036]
    106367801
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106367801
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106367801
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106367801
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106367801
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106367801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106367801
NCBI-ProteinID: XP_013663111
AA seq 358 aa AA seqDB search
MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaattcgccgatgagctgatcgctaacgctgcctacatcggc
acacctggaaaaggtattctcgccgccgatgagtccaccggtaccatcggaaagcgtctc
gctagcatcaacgtcgagaacgttgaaaccaacagacgtgctctccgtgagcttctcttc
accgcccccggtgctctcccttgcctcagcggtgtcatcctcttcgaagagactctttac
caaaagagctccgatggcaagcttttcgttgatattttgaaggaaggaggagtcctccca
ggtatcaaagtcgacaagggtaccgttgagctagccggaaccaacggtgagaccaccact
caaggtcttgacggtctcggtgagcgttgcaagaagtactacgaagctggtgcccgtttc
gccaagtggcgtgcggttctcaagatcggcgagaacgagccatcagagcattccatccac
gagaacgcttacgggttggctagatacgctgtcatctgccaggagaacggtcttgtacca
atcgttgagcctgagatccttgtcgacggatcccacgacatccacaagtgtgctgccgtc
accgagcgtgtccttgcggcttgctacaaggctcttagcgaccaccacgttttgcttgag
ggaactttgttgaagcctaacatggtcacacctggatccgacagtgccaaggtcgcgcct
gaggttatcgctgagcacaccgtccgtgctcttcagagaacggtaccagcagctgttcca
gctattgttttcttgtctggtggacagagcgaggaggaggcgaccaagaacttgaacgcg
atgaaccagttgaagaccaagaagccatggtcattgtctttctcgttcggacgtgcgttg
caacagagcactttgaagacatgggcagggaaagaggagaatgttaaggctgctcaagag
gcgttgtatgtgaggtgcaaggctaactctgaagccacacttggaacgtacaaaggtgat
gctaagcttggtgatggagctgcagagagccttcacgtgaaggactacaagtactga

KEGG   Brassica napus (rape): 106367922Help
Entry
106367922         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic isoform X1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106367922
   00030 Pentose phosphate pathway
    106367922
   00051 Fructose and mannose metabolism
    106367922
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106367922
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106367922
   03036 Chromosome and associated proteins [BR:bna03036]
    106367922
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106367922
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106367922
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106367922
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106367922
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106367922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106367922
NCBI-ProteinID: XP_013663245
AA seq 358 aa AA seqDB search
MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaattcgccgatgagctgatcgctaacgctgcatacatcggc
acacctggaaaaggtattctcgccgccgatgagtccaccggtaccatcggaaagcgtctc
gcgagcatcaacgtcgagaacgttgagactaacagacgtgctctccgtgagcttctcttc
accgcccccggtgctctcccttgcctcagcggtgtcatcctcttcgaagagactctttac
caaaagagctccgatggcaagcttttcgttgatatcttgaaggaaggaggagtcctccca
ggtatcaaagtcgacaagggtaccgttgagctagccggaaccaacggcgagaccaccacc
caaggtctcgacggtctcggtgagcgttgcaagaagtactacgaagctggtgcacgtttc
gccaaatggcgtgcggttctcaagatcggcgagaacgagccatcagagcattctatccac
gagaacgcttacgggttggctagatacgctgtcatctgccaggagaacggtcttgtaccg
atcgttgagcctgagatccttgtcgacggatcccacgacatccacaagtgtgctgccgtc
accgagcgtgtccttgcggcttgctacaaggctcttagcgaccaccacgttttgcttgag
ggaactttgttgaagcctaacatggtgacgcctggatccgacagtgccaaggttgcacct
gaggttatcgctgagcacaccgtccgtgctcttcagagaacggtaccagcagctgttcca
gctattgttttcttgtccggtggacagagcgaggaggaggcgactaagaacttgaacgcg
atgaaccagttgaagaccaagaagccatggtcgttgtctttctccttcggacgtgcgttg
caacagagcacattgaagacatgggcggggaaagaggagaatgttaaggctgctcaagag
gcgttgtatgtgaggtgcaaggctaactctgaagccacacttggaacgtacaaaggtgat
gctaagcttggtgatggagctgcagagagccttcacgtgaaggactacaagtactga

KEGG   Brassica napus (rape): 106368818Help
Entry
106368818         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106368818
   00030 Pentose phosphate pathway
    106368818
   00051 Fructose and mannose metabolism
    106368818
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106368818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106368818
   03036 Chromosome and associated proteins [BR:bna03036]
    106368818
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106368818
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106368818
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106368818
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106368818
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106368818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106368818
NCBI-ProteinID: XP_013664323
AA seq 400 aa AA seqDB search
MASSSASLLKASPVKSDWVKGQSLLVRQPSSSVAAIRSNVSPSALTVRAASAYADELVKT
AKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILF
EETLYQSTVDGKKMVDVLVDQNIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRTAAYYQ
QGARFAKWRTVVSIPNGPSALAVQEAAWGLARYAAISQDSGLVPIVEPEILLDGEHNIDR
TYEVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRI
PPAVPGIMFLSGGQSELEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKA
AQETLLTRAKANSLAQLGIYTGEGESEDAKEGMFVKGYTY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagctcagcgtctcttctcaaagcctcaccagtgaaatctgattgggttaag
ggacagagtctcctcgtccgtcaaccttcttcctccgtcgcagctatccgaagcaacgta
tcaccttctgctctcaccgtccgtgccgcctctgcttacgcggacgagctcgtcaaaaca
gctaaaacaatcgcgtctccgggacgcggaatattggcgatggacgagtcaaacgcgact
tgcggcaagcgtttggcgtcgatcgggctagagaacacggaagctaaccgtcaggcttac
aggacgctgcttgtgtcagctccaggattgggacagtacatctccggagctatcctcttc
gaggaaactctctaccagtccaccgttgacggcaagaaaatggtcgatgttctcgtcgac
cagaacatcgtccctggcatcaaagtcgacaagggtttggtgccacttgttgggtctaac
gacgagtcatggtgccaaggactcgacggtttggcctctcgtaccgctgcttactaccaa
caaggtgctcgtttcgccaaatggcgtactgttgtgagcattccaaatggaccctctgct
ttggctgttcaagaagcagcttggggacttgcccgctacgccgctatctctcaggacagc
ggtttggtacccattgtggagccggagattctgctggacggagaacataacattgacagg
acatacgaggttgcagagaaggtctgggctgaggtcttcttctacctcgctcagaacaac
gtcatgttcgaaggcatcctcctgaagccgagcatggttactcctggtgctgagtccaaa
gacagagctactcccgagcaagttgcttcctacactctcaagctccttcgcaacagaatc
cctcctgctgttcccggaatcatgttcctgtccggtggacagtccgagttggaggcgact
ttgaacctgaacgcaatgaaccaaggaccgaacccatggcacgtgtcattctcctacgca
cgtgcgttgcagaacacttgcttgaagacatggggaggcagagaggagaacgtgaaggcg
gctcaggagacactcttgacccgtgccaaagccaattcgctggctcagctcgggatatac
acaggagaaggtgagtccgaggacgccaaggagggtatgttcgtaaaaggctacacctac
taa

KEGG   Brassica napus (rape): 106370013Help
Entry
106370013         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 4, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106370013
   00030 Pentose phosphate pathway
    106370013
   00051 Fructose and mannose metabolism
    106370013
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106370013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106370013
   03036 Chromosome and associated proteins [BR:bna03036]
    106370013
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106370013
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106370013
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106370013
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106370013
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106370013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106370013
NCBI-ProteinID: XP_013665550
AA seq 288 aa AA seqDB search
MSCFKSKYADELIANAAYIGSPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF
TTPGALQYISGIILFEETLYQKTASGKPFVDVMKEAKVLPGIKVDKGTVELAGTNGETTT
IGLDGLGDRCKKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDSKSRAE
PKVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEQATVNLNACVGFNGG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcttcaagtccaaatacgccgatgagctcatcgccaatgctgcttacatcggt
tctccagggaaaggtattctcgccgctgatgaatccacagggaccatcggaaaacgtttc
gcaagcattaacgtcgagaacgttgaatcaaacagacgtgctttacgtgagctcttgttc
accactccaggagctctccaatacatcagtggtatcatcctctttgaggaaactctctac
cagaaaacagcttcaggtaaaccatttgttgatgtaatgaaggaagctaaagtccttccc
ggtatcaaagtcgataaaggaactgtcgagctcgctggtacaaatggtgaaaccacaacc
attggcctcgacgggctcggagaccgttgcaagaaatactatgaagcaggtgcacgtttt
gccaaatggcgtgccgttctcaaaatcggagccaacgagccttcggagttagccatccac
gaaaacgcttacggtctagcgagatatgccgtcatttgccaagagaacggtctcgtcccc
atcgtggaaccagagatcctcgtggacggatcccacgatattgagaaatgtgcttacgtc
acggaacgtgtcctcgcggcttgttataaggctcttaatgatcaccacgtgatcttagaa
ggaacgctcttgaaaccaaacatggttactccaggctccgatagtaagtctagggctgaa
cccaaagtgatcgcagagcacacggtccgtgcattacagcgtactgtccccgccgcggtt
ccagccgttgtgttcttgtctggaggacagagtgaggaacaagcaactgtgaatttaaac
gcctgcgttggctttaacggtggc

KEGG   Brassica napus (rape): 106372316Help
Entry
106372316         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106372316
   00030 Pentose phosphate pathway
    106372316
   00051 Fructose and mannose metabolism
    106372316
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106372316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106372316
   03036 Chromosome and associated proteins [BR:bna03036]
    106372316
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106372316
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106372316
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106372316
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106372316
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106372316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106372316
NCBI-ProteinID: XP_013667954
AA seq 400 aa AA seqDB search
MASSSASLLKASPVKSDWVKGQSLLVRQPSSSVAAIRSNVSPSALTVRAASAYADELVKT
AKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILF
EETLYQSTVDGKKMVDVLVDQNIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRTAAYYQ
QGARFAKWRTVVSIPNGPSALAVQEAAWGLARYAAISQDSGLVPIVEPEILLDGEHNIDR
TYEVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRI
PPAVPGIMFLSGGQSELEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKA
AQETLLTRAKANSLAQLGIYTGEGESEDAKEGMFVKGYTY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagctcagcgtctcttctcaaagcctcaccagtgaaatctgattgggttaag
ggacagagtctcctcgtccgtcaaccttcttcctccgtcgcagctatccgaagcaacgta
tcaccttctgctctcaccgtccgtgccgcctctgcttacgcggacgagctcgtcaaaaca
gctaaaacaatcgcgtctccgggacgcggaatattggcgatggacgagtcaaacgcgact
tgcggcaagcgtttggcgtcgatcgggctagagaacacggaagctaaccgtcaggcttac
aggacgctgcttgtgtcagctccaggattgggacagtacatctccggagctatcctcttc
gaggaaactctctaccagtccaccgttgacggcaagaaaatggtcgatgttctcgtcgac
cagaacatcgtccctggcatcaaagtcgacaagggtttggtgccacttgttgggtctaac
gacgagtcatggtgccaaggactcgacggtttggcctctcgtaccgctgcttactaccaa
caaggtgctcgtttcgccaaatggcgtactgttgtgagcattccaaatggaccctctgct
ttggctgttcaagaagcagcttggggacttgcccgctacgccgctatctctcaggacagc
ggtttggtacccattgtggagccggagattctgctggacggagaacataacattgacagg
acatacgaggttgcagagaaggtctgggctgaggtcttcttctacctcgctcagaacaac
gtcatgttcgaaggcatcctcctgaagccgagcatggttactcctggtgctgagtccaaa
gacagagctactcccgagcaagttgcttcctacactctcaagctccttcgcaacagaatc
cctcctgctgttcccggaatcatgttcctgtccggtggacagtccgagttggaggcgact
ttgaacctgaacgcaatgaaccaaggaccgaacccatggcacgtgtcattctcctacgca
cgtgcgttgcagaacacttgcttgaagacatggggaggcagagaggagaacgtgaaggcg
gctcaggagacactcttgacccgtgccaaagccaattcgctggctcagctcgggatatac
acaggagaaggtgagtccgaggacgccaaggagggtatgttcgtaaaaggctacacctac
taa

KEGG   Brassica napus (rape): 106372647Help
Entry
106372647         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 4, cytosolic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106372647
   00030 Pentose phosphate pathway
    106372647
   00051 Fructose and mannose metabolism
    106372647
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106372647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106372647
   03036 Chromosome and associated proteins [BR:bna03036]
    106372647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106372647
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106372647
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106372647
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106372647
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106372647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106372647
NCBI-ProteinID: XP_013668363
AA seq 359 aa AA seqDB search
MSCFKSKYADELIANAAYIGSPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF
TTPGALQYISGIILFEETLYQKTASGKPFVDVMKEAKVLPGIKVDKGTVELAGTNGETTT
IGLDGLGDRCKKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDSKSRAE
PKVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEQATVNLNAINQLKGKKPWSLTFSYGRA
LQQSTLKAWGGKEENVEKAQKAFLARAKANSEATTGAYKGDAQLGEGASESLHVKDYKY
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcttcaagtccaaatacgccgatgagctcatcgccaatgctgcttacatcggt
tctccagggaaaggtattctcgccgctgatgaatccacagggaccatcggaaaacgtttc
gcaagcattaacgtcgagaacgttgaatcaaacagacgtgctttacgtgagctcttgttc
accactccaggagctctccaatacatcagtggtatcatcctctttgaggaaactctctac
cagaaaacagcttcaggtaaaccatttgttgatgtaatgaaggaagctaaagtccttccc
ggtatcaaagtcgataaaggaactgtcgagctcgctggtacaaatggtgaaaccacaacc
attggcctcgacgggctcggagaccgttgcaagaaatactatgaagcaggtgcacgtttt
gccaaatggcgtgccgttctcaaaatcggagccaacgagccttcggagttagccatccac
gaaaacgcttacggtctagcgagatatgccgtcatttgccaagagaacggtctcgtcccc
atcgtggaaccagagatcctcgtggacggatcccacgatattgagaaatgtgcttacgtc
acggaacgtgtcctcgcggcttgttataaggctcttaatgatcaccacgtgatcttagaa
ggaacgctcttgaaaccaaacatggttactccaggctccgatagtaagtctagggctgaa
cccaaagtgatcgcagagcacacggtccgtgcattacagcgtactgtccccgccgcggtt
ccagccgttgtgttcttgtctggaggacagagtgaggaacaagcaactgtgaatttaaac
gccattaatcagctcaaaggtaagaaaccgtggagcttgacgttttcgtatggacgtgcg
cttcagcagagtacactcaaggcttggggaggtaaagaggagaatgttgagaaggctcaa
aaggcgttcttggctcgagccaaggctaactcggaggcaactactggtgcctacaaaggt
gatgctcagctcggtgaaggtgcttctgagagccttcacgttaaagactacaaatactaa

KEGG   Brassica napus (rape): 106381931Help
Entry
106381931         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 3, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106381931
   00030 Pentose phosphate pathway
    106381931
   00051 Fructose and mannose metabolism
    106381931
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106381931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106381931
   03036 Chromosome and associated proteins [BR:bna03036]
    106381931
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106381931
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106381931
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106381931
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106381931
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106381931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106381931
NCBI-ProteinID: XP_013677322
UniProt: A0A078HKF7
AA seq 389 aa AA seqDB search
MASASFVKLNALSSPRISHRSFAHPSASPPPRVSFAIRAGAYSDELVKTAKTIASPGRGI
LAIDESNATCGKRLASIGLDNTEENRQAYRQLLLTTPGLGDYISGAILFEETLYQSTKDG
KKFVDCLNDAKIVPGIKVDKGLVPLPGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTV
VSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSE
VFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVAEYTLTMLKRRVPPAVPGIMFLS
GGQSEAEATLNLNAMNQSPNPWHVSFSYARALQNSVLRTWQGKPEKIEDSQKALLVRAKA
NSLAQLGKYSAEGENEDAKKGMFVKGYTY
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcaagcttcgtcaagctaaacgctctctcttctcctcggatcagccaccgc
tccttcgctcacccctccgcctctcctcctcctcgtgtctccttcgcgatccgcgccggt
gcttactccgacgaactcgtcaaaaccgccaaaaccatcgcatcccctgggagaggtata
ctagcgatcgacgagtctaacgcgacttgcgggaagaggctcgcttcgattgggttggac
aacaccgaggagaaccgtcaagcctacaggcagcttctgctaaccacgcccggcctcgga
gactacatctccggtgccattctcttcgaagagactctttaccagtccaccaaagacggc
aagaagtttgtcgattgcttgaacgatgccaagatcgtccccgggatcaaagttgacaag
ggcttggttccccttcctggctccaacgaagagtcttggtgccaaggcttggatggattg
gcttcacgttccgctgagtactacaagcaaggcgctcgtttcgccaagtggaggacagtt
gtgagtattccttgcggtccttcagcactagctgtcaaggaagctgcgtgggggttagct
cgctatgcagccatctctcaggacaacgggcttgtgccaatagtggagccagagattctt
ctggatggtgaccacccgattgagaggacgcttgaggttgctgagaaagtgtggtctgag
gtgttcttctacttggcgcagaacaatgttatgtttgaggggatattgttgaagcccagc
atggttacaccaggtgctgagcacaagaacaaggcctctcccgagaccgtcgctgagtac
acgctcaccatgctcaagaggagagttccaccggctgttccagggatcatgtttctgtct
ggaggacagtctgaggcggaggctacgctgaacctgaacgccatgaaccagagcccgaac
ccgtggcatgtgtccttctcctacgcgcgtgccctgcagaactctgtgctcaggacgtgg
caagggaaacccgagaagatcgaggactcgcagaaggctctattggttagggcaaaggcc
aactcactggcacagctcgggaaatactcagcggagggagagaatgaagatgccaagaaa
ggaatgttcgtcaagggttacacctactga

KEGG   Brassica napus (rape): 106382027Help
Entry
106382027         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106382027
   00030 Pentose phosphate pathway
    106382027
   00051 Fructose and mannose metabolism
    106382027
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106382027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106382027
   03036 Chromosome and associated proteins [BR:bna03036]
    106382027
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106382027
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106382027
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106382027
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106382027
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106382027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106382027
NCBI-ProteinID: XP_013677439
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAVVIRNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctcctgtgttggacaaatcggagtgggtcaag
ggacaaagcgttctcttccgtcagccatcttccgccgcagtcgtcatacgtaaccgtgcc
acctcccttaccgtccgtgccgcttcttcctacgccgatgagcttgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgacaagcatacaggaca
ttgctggtctctgcaccaggactcggacagtacatctccggtgcaatcctgttcgaggag
actctgtatcagtcgaccaccgaaggcaagaaaatggtcgacgtccttgtcgagcagaac
atcgtccccggtatcaaagtcgacaagggtttggtcccacttgttggctctaacaatgag
tcatggtgccaagggctcgatggtctatcctcccgaactgctgcttactatcaacagggt
gctcgtttcgccaaatggcgtactgtcgtgagcattcccaatggtccgtctgctctagct
gttaaagaagctgcttggggccttgcccgatacgctgccatttcacaagacagtggattg
gttccaatagtggagccagagatattgttggacggagaacacgacatcgacaggacttac
gaagtagcagagaaggtctgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtattcttctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaaactcctccgcaacagaatccctccg
gccgtccccggaatcatgttcttgtcgggaggacagtctgagttggaggcaacgttgaac
ctgaacgcgatgaaccaagcaccaaacccgtggcatgtatccttctcctacgcacgtgcc
ctgcagaacacatgtttgaaaacatggggaggcagagctgagaacgtgaacgcagctcag
accactctattggctagagccaaggccaattcgctggctcagcttggaaaatacacagga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattga

KEGG   Brassica napus (rape): 106389141Help
Entry
106389141         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106389141
   00030 Pentose phosphate pathway
    106389141
   00051 Fructose and mannose metabolism
    106389141
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106389141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106389141
   03036 Chromosome and associated proteins [BR:bna03036]
    106389141
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106389141
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106389141
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106389141
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106389141
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106389141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106389141
NCBI-ProteinID: XP_013684789
UniProt: A0A078JFE6
AA seq 358 aa AA seqDB search
MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPPAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaatacgccgatgagttgatcgctaacgctgcttacatcggc
acacccgggaagggtattctcgccgccgatgagtccaccggtaccatcggaaagcgtctt
gccagcatcaacgtcgagaacgttgagaccaacagacgtgctctccgcgagcttctcttc
accgcccctggtgctctcccttgcctcagtggtgtcatcctcttcgaggaaactctttac
caaaagagttccgatggcaagcttttcgttgatatcttgaaggaaggaggagttcttcca
ggtatcaaagtcgacaagggtaccgtcgagctagccggaaccaacggtgagaccaccact
cagggtctcgacggtctcggtgagcgttgcaagaagtactacgaagctggtgcccgtttc
gccaagtggcgtgcggtcctcaagatcggcgagaacgagccatcagagcactccatccac
gagaacgcttacggattggctagatacgctgttatctgccaggagaatggtcttgtgccc
attgttgagcctgagatcctcgtcgacggatcccatgacatccacaagtgtgctgccgtc
actgagcgtgtccttgctgcttgctacaaggctcttagcgaccaccacgtcttgcttgag
ggaactttgttgaagcccaacatggtcacccctggttccgacagtgccaaggttgctcca
gaggttatcgctgagcacaccgtccgtgctcttcagagaaccgtcccaccagctgttcca
gctatcgtgttcttgtccggaggacagagcgaggaggaggcgactaagaacttgaacgcg
atgaaccagttgaagaccaagaagccatggtcattgtctttctctttcggacgtgcgttg
cagcagagcactttgaagacatgggcgggtaaagaggagaacgtcaaggccgctcaagag
gccttgtacgtgaggtgcaaggctaactctgaagccacactaggaacatacaaaggtgat
gctaagcttggtgatggagccgcggagagccttcacgtgaaggactacaagtactga

KEGG   Brassica napus (rape): 106391482Help
Entry
106391482         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 6, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106391482
   00030 Pentose phosphate pathway
    106391482
   00051 Fructose and mannose metabolism
    106391482
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106391482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106391482
   03036 Chromosome and associated proteins [BR:bna03036]
    106391482
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106391482
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106391482
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106391482
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106391482
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106391482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 106391482
NCBI-ProteinID: XP_013687601
AA seq 358 aa AA seqDB search
MASFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF
TTPGALPCLSGVILFEETLYQKSSKGTPFVDILKEGGVLPGIKVDKGTVSLPGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGPTEPSELAIRENAYGLARYAAICQENGLVP
IVEPEILVDGSHDIQKCAEVTERVLAACYKALSDHHVMLEGTLLKPNMVTPGSESGKVAP
EVVAEYTVRALQRTVPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWGGKEENVKKAQEAFLVRCKANSEATLGVYKGDAQLGEGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttcaccagcaaatacgccgatgagctgatcgctaacgctgcctacatcggc
acacccggaaagggcatcctcgcagcagacgaatcaaccggcacaatcggaaaacgtctc
tctagcatcaacgtagagaacgtcgagtccaacagacgcgctctccgtgagcttctcttc
accactccaggcgcacttccttgcctcagcggtgtcatcctctttgaagaaactctatac
caaaaaagctccaaagggacgccttttgtggatattctgaaggaaggaggagtcttacct
ggcatcaaagtcgacaagggcaccgtttctctacccggaaccaacggcgagaccaccaca
cagggcctcgacggtctcggcgagcgttgcaagaagtactacgaggccggtgctcgtttc
gccaaatggcgtgcggttctcaagatcggccccaccgagccatcagagctagccatccgc
gagaacgcttacgggctcgctagatacgctgccatctgtcaggagaacggtcttgtcccc
atcgtggagcctgagattctcgttgacggttctcacgatattcagaagtgcgcggaggtg
acggagcgtgtcttagcagcttgctacaaggccctgagcgatcaccatgtgatgctcgaa
ggaacgcttctgaaaccgaacatggtgactccagggtcagagagtggtaaagttgcgccg
gaggtggtggcggagtatactgtccgtgcgctgcagaggacggtgcctgcggctgttccg
gctgtggtgttcttgtcgggagggcaaagcgaggaagaggcgacgaggaacctgaacgcg
atgaaccagctgaagactaagaagccttggtcgctgtcgttttcgtttgggagggcgttg
cagcagagcacgttgaagacttggggagggaaagaagagaatgtgaagaaggcgcaagag
gcgttcttggttaggtgcaaggctaactctgaggctacgcttggtgtttacaaaggtgat
gctcagcttggtgaaggtgcggcggagagccttcacgttaaggactacaagtactaa

KEGG   Brassica napus (rape): 106395718Help
Entry
106395718         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 6, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106395718
   00030 Pentose phosphate pathway
    106395718
   00051 Fructose and mannose metabolism
    106395718
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106395718
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106395718
   03036 Chromosome and associated proteins [BR:bna03036]
    106395718
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106395718
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106395718
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106395718
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106395718
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106395718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106395718
NCBI-ProteinID: XP_013691552
AA seq 343 aa AA seqDB search
MASFTTKYADELIANAAYIGTPGKGILAADESTDTIGKRFSSVNVENVDSNRRALRELLF
TTPGALPCISGVILVEETLYQKSSTGTSFVDILKEGGVLPGIKVDKGRAVELAGTNSETI
TQGLDGLGERCKKYYEAGARFAKWHALLKIGPNEPSELAIHENAYGLARYAAICQENGLV
PIVEPDVSVDGSHDIHKCAEVTERFLAACYKALSDHHVMLEGTLLKPNMVTPGSESAKVA
PEVVAEYTVRALLRTVPAAVPAILFMSGGQSEEEATRNLNAMNQLKTKKPWSLSFCFGRA
LQQSALKTWGGKEENVQRAQDALLVRCKANSEATLGTYNEPSG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttcaccaccaaatacgccgatgagcttatcgccaacgctgcctacattggt
acacctggaaagggtatcctcgctgctgatgaatcaaccgataccattggaaagcgtttc
tcgagcgtcaacgtcgagaacgttgattctaacagacgtgctctccgcgagcttctcttc
accactcctggtgctcttccttgcatcagtggtgtcatcctcgttgaagaaactctctac
cagaaaagctctacagggacgtcttttgtggacattttgaaggaaggtggagtcttgcct
ggtattaaggttgacaagggccgtgccgttgagctagctggaaccaacagtgagaccatc
acacagggtcttgatggtcttggcgaacgttgcaagaagtactacgaggcgggtgctcgt
tttgctaagtggcatgcactccttaagattggcccgaacgagccatcagagttagccatt
cacgagaacgcttatggactggctagatacgcggcgatttgtcaagagaacggtcttgta
cccattgtggagcctgatgtttctgttgatgggtctcatgatatccacaagtgtgcagag
gtgacagagcgtttccttgcagcttgctacaaagccctgagtgatcaccatgtgatgctt
gaaggaacgcttctgaaaccaaacatggtgactccaggatcggagagcgctaaagttgca
ccagaggtcgtcgcggagtacactgtccgtgcccttctgaggaccgtgccagcagctgtt
ccagccatactgttcatgtcgggagggcagagcgaggaagaggcgacaagaaacctgaat
gcgatgaaccagctgaagacaaagaagccttggtctctgtcgttttgctttggaagggcg
ttgcagcagagcgcgcttaagacttggggagggaaggaggagaatgtgcagagggcgcaa
gatgcgttgttggttaggtgcaaggctaactctgaggctacacttggtacttacaatgag
ccttcaggttaa

KEGG   Brassica napus (rape): 106405688Help
Entry
106405688         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106405688
   00030 Pentose phosphate pathway
    106405688
   00051 Fructose and mannose metabolism
    106405688
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106405688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106405688
   03036 Chromosome and associated proteins [BR:bna03036]
    106405688
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106405688
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106405688
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106405688
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106405688
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106405688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106405688
NCBI-ProteinID: XP_013701672
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSASVVLPNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctccagtgctggacaaatctgagtgggtcaag
ggccaaagcgttctcttccgtcagccttcttccgcatccgtcgtactacctaaccgtgcc
acatctctcaccgtccgtgccgcttcttcctacgccgatgagcttgtcaagacagcgaaa
acaattgcatctccgggacgtggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcgtacaggact
ttgcttgtctctgcaccaggtctcggacagtacatctccggggcaatcttgttcgaggag
actctctatcagtccaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcaaaac
atcgtccccggtatcaaagttgacaagggtttggtgccacttgttggctctaacaatgag
tcatggtgtcaaggactcgatggtctatcctctcgcactgctgcttactaccaacagggt
gctcgtttcgctaaatggcgtactgtcgtgagcattcccaacggcccgtctgcactcgct
gtgaaagaagctgcttggggccttgctcgctacgctgccatttcacaggacagtggattg
gtcccaattgtggagccagagatcttgttggacggagaacacgacattgacaggacttac
gaagttgctgagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgccgcctacacccttaagctcctccgcaacagaatccctcct
gccgtccccggaatcatgttcttgtccggaggacagtctgagttggaggcaacgttgaac
ctcaacgcgatgaaccaggcaccaaacccatggcacgtgtccttctcctacgcacgtgct
ctccagaacacttgtctgaaaacatggggaggcagagctgagaacgtgaacgctgctcag
accactctcttggctcgtgccaaggccaactcgttggctcagcttggaaaatacaccgga
gaaggcgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattga

KEGG   Brassica napus (rape): 106410387Help
Entry
106410387         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106410387
   00030 Pentose phosphate pathway
    106410387
   00051 Fructose and mannose metabolism
    106410387
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106410387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106410387
   03036 Chromosome and associated proteins [BR:bna03036]
    106410387
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106410387
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106410387
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106410387
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106410387
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106410387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106410387
NCBI-ProteinID: XP_013706335
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAVVLRNRATSITVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQHG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLTRAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcttctccagtgttggacaaatctgagtgggtcaag
ggccaaagtgttctcttccgtcagccttcctccgccgcagtcgtcctacgcaaccgtgcc
acctccattaccgtccgcgccgcttcttcctacgccgatgagctcgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacatgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcataccggacg
ctgcttgtctctgcaccaggtctcggacagtacatctccggtgcaatcctgttcgaggag
actctgtatcagtctaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcaaaac
attgttcccggtatcaaagttgacaagggtctggtgccacttgttggatctaacaatgag
tcatggtgccaaggactcgacggtctatcctctcggaccgctgcttactaccaacatggt
gctcgtttcgccaaatggcgtactgtggtgagcattcccaacggtccgtctgctctagct
gtgaaagaagctgcttggggccttgctcgatacgctgccatttcacaagacagtggattg
gttccaatagtggagccagagatattgttggacggagaacacgacattgacaggacttac
gaagtagcagagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactccaggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaagctcctccgcaacagaatccctcct
gccgtccccggaatcatgttcttgtcgggaggacagtctgagttggaggcaacgttgaac
ctgaacgccatgaaccaggcaccaaacccgtggcacgtgtccttctcctacgcacgtgct
cttcagaacacttgcctgaaaacctggggaggcagagctgagaacgtgaacgcagctcag
accactctcttgactcgagccaaggccaattcgttggctcagctcggcaaatacaccgga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctactga

KEGG   Brassica napus (rape): 106415318Help
Entry
106415318         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106415318
   00030 Pentose phosphate pathway
    106415318
   00051 Fructose and mannose metabolism
    106415318
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106415318
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106415318
   03036 Chromosome and associated proteins [BR:bna03036]
    106415318
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106415318
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106415318
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106415318
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106415318
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106415318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106415318
NCBI-ProteinID: XP_013711436
AA seq 398 aa AA seqDB search
MASSSASLLKASPVKSDWVKGQSLLIRQPSSVAAIRSNAAPSALTVRAASYADELVKTAK
TIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTVDGKKMVDVLVDQNIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVQEAAWGLARYAAISQDSGLVPIVEPEILLDGEHNIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEKVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKAAQ
ETLLTRAKANSLAQLGKYTGEGESEDAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagctctgcgtctcttctcaaagcctcaccggtgaaatctgattgggttaag
ggacagagtctcctcatccgtcaaccatcctcagtcgcagctatccgcagcaacgcagca
ccttccgctctcaccgtccgtgcggcctcttacgccgacgagctcgtcaaaacagctaaa
acaatcgcgtccccgggacgcggaatattggcgatggacgagtcaaacgcgacttgcggg
aagcgtttggcgtcgatcgggctagagaacacggaggctaaccgtcaggcttacaggacg
ctgcttgtgtcagctccgggattgggacagtacatctccggagctatcctcttcgaggaa
actctctaccagtccaccgttgacggcaagaaaatggtcgatgttctggtcgaccagaac
atagtccctggcatcaaagtcgacaagggtttggtgccgcttgttgggtctaacgacgag
tcatggtgccaaggactcgacggtttggcctctcgtaccgctgcttactaccaacaaggt
gctcgtttcgccaaatggcgtactgttgtgagcattccaaatggaccctctgctttggct
gttcaagaagcagcttggggacttgcccgctatgcagctatctctcaggacagcggtctg
gtacccattgtggagccggagattctgttggacggagaacacaacattgacaggacatac
gaggttgcagagaaggtctgggctgaggtcttcttctacctcgctcagaacaacgtcatg
ttcgaaggcatcctcctgaagccgagcatggttactcctggtgctgagtccaaagacaga
gctactcccgagaaagttgcttcctacactctcaagctccttcgcaacagaatccctccc
gctgttcccggaatcatgttcctgtccggtggacagtccgagttggaggcgactttgaac
ctgaacgcaatgaaccaaggaccgaacccgtggcacgtgtccttctcctacgcacgtgca
ttgcagaacacttgcttgaagacatggggaggcagagaagagaacgtgaaagcggctcag
gagacactcttgacccgtgccaaagccaattcgctggctcagctcgggaaatacacagga
gaaggtgagtccgaggacgccaaggagggtatgttcgtaaaaggctacacctactaa

KEGG   Brassica napus (rape): 106420760Help
Entry
106420760         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106420760
   00030 Pentose phosphate pathway
    106420760
   00051 Fructose and mannose metabolism
    106420760
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106420760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106420760
   03036 Chromosome and associated proteins [BR:bna03036]
    106420760
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106420760
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106420760
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106420760
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106420760
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106420760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106420760
NCBI-ProteinID: XP_013717056
AA seq 399 aa AA seqDB search
MASSSATLFKASPVKSDWLKGQSLLLRQPSSVSPIRSHVAPSALTVHAASAYADELVKTA
KTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFE
ETLYQSTVDGKKMVDVLVQQNIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRTAAYYQQ
GARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHCIDRT
YEVAEKVWSEVFFYLSQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRSRVP
PAVPGIMFLSGGQSELEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKAA
QDTLLTRAKANSLAQLGKYTGEGESEDAKEGMFVKGYTY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagctctgcgactctgttcaaagcctcgccggtgaaatccgactggcttaaa
ggacagagtctcctactccgtcaaccttcctccgtctcgcctatccgcagccacgtggca
ccttccgctctcaccgtccatgccgcctctgcctacgccgacgagctcgtcaaaacagct
aaaacaatcgcgtctccgggacgcggaatcttagcgatggacgagtcaaacgcgacttgc
gggaagcgtttagcgtcaattgggctagagaacacagaggctaaccgtcaggcttaccgg
acactgcttgtgtcggctccaggactgggacagtacatctccggagctatcctgttcgag
gaaactctctaccagtccaccgtcgacggcaagaaaatggtcgacgttctcgtccagcag
aacatcgtccctggcatcaaagtcgacaagggtttggtgccacttgttgggtctaacgac
gagtcatggtgccaaggacttgacggtttagcctctcgtaccgctgcttactaccagcaa
ggtgctcgcttcgccaaatggcgtactgttgtgagcattccaaatggaccttctgctttg
gctgttaaagaggcagcctggggacttgcccgctacgccgctatttctcaggatagcggt
ctggtaccgattgtggagccggagattatgttggacggagaacactgcattgacaggaca
tacgaggttgcggagaaggtctggtctgaggtcttcttctatctctctcagaacaacgtc
atgttcgaaggtatcctcctgaagccaagcatggttactcctggtgctgagtccaaagac
agagctactcccgagcaagttgcttcctacactctcaagctccttcgcagcagagttcct
cccgctgttcccggaatcatgttcctgtctggtggacagtccgagttggaggcgaccttg
aacctgaacgcaatgaaccaaggaccgaacccatggcacgtgtccttctcctatgcacgt
gccttgcagaacacttgcttgaagacatggggaggcagagaagagaacgtgaaggcggct
caggacactctcttgacccgagccaaagcgaactcgctggctcagctcgggaaatacaca
ggggaaggtgagtccgaggatgccaaggagggtatgtttgtaaaaggctacacctattaa

KEGG   Brassica napus (rape): 106420807Help
Entry
106420807         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106420807
   00030 Pentose phosphate pathway
    106420807
   00051 Fructose and mannose metabolism
    106420807
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106420807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106420807
   03036 Chromosome and associated proteins [BR:bna03036]
    106420807
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106420807
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106420807
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106420807
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106420807
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106420807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106420807
NCBI-ProteinID: XP_013717113
AA seq 143 aa AA seqDB search
QALWILTGILLKPSMVTPGAESKDRATPEQVASYTLKLLRSRVPPAVPGIMFLSGGQSEL
EATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKAAQDTLLTRAKANSLAQL
GKYTGEGESEDAKEGMFVKGYTY
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
caagctttgtggattttaacaggtatcctcctgaagccaagcatggttactcctggtgct
gagtccaaagacagagctactcccgagcaagttgcttcctacactctcaagctccttcgc
agcagagttcctcccgctgttcccggaatcatgttcctgtctggtggacagtccgagttg
gaggcgaccttgaacctgaacgcaatgaaccaaggaccgaacccatggcacgtgtccttc
tcctatgcacgtgccttgcagaacacttgcttgaagacatggggaggcagagaagagaac
gtgaaggcggctcaggacactctcttgacccgagccaaagcgaactcgctggctcagctc
gggaaatacacaggggaaggtgagtccgaggatgccaaggagggtatgtttgtaaaaggc
tacacctattaa

KEGG   Brassica napus (rape): 106425542Help
Entry
106425542         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106425542
   00030 Pentose phosphate pathway
    106425542
   00051 Fructose and mannose metabolism
    106425542
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106425542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106425542
   03036 Chromosome and associated proteins [BR:bna03036]
    106425542
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106425542
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106425542
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106425542
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106425542
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106425542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106425542
NCBI-ProteinID: XP_013721718
AA seq 358 aa AA seqDB search
MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLVACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPPAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaatacgccgatgagttgatcgctaacgctgcctacatcgga
acacccgggaagggtattctcgccgccgatgagtccaccggtaccatcggaaagcgtctt
gcgagcatcaacgtcgagaacgttgagaccaacagacgtgctctccgtgagcttctcttc
accgcccctggtgctctcccttgcctcagcggtgtcatcctcttcgaggaaactctttac
caaaagagctccgatggaaagcttttcgttgatatcttgaaggaaggaggagttcttcca
ggtatcaaagtcgacaagggtaccgtcgaactagccggaaccaacggtgagaccaccact
cagggtctcgacggtctcggtgagcgttgcaagaagtactacgaggccggtgcacgtttc
gccaagtggcgtgcggtccttaagatcggcgagaacgagccatcagagcattccatccac
gagaacgcttacgggttggctagatacgctgttatctgccaggagaacggtcttgtgccc
atcgttgagcctgagatcctcgtcgacggatcccatgacatccacaagtgtgctgccgtc
actgagcgtgtccttgttgcttgctacaaggctcttagcgaccaccacgtcttgcttgag
ggaactttgttgaagcctaacatggtcacaccgggttccgacagtgccaaggttgcgccg
gaggttatcgctgagcacaccgttcgtgctcttcagagaaccgtcccaccggctgttcca
gctattgttttcttgtctggaggacagagcgaggaggaggcgaccaagaacttgaacgcg
atgaaccagttgaagaccaagaagccatggtcattgtctttctctttcggacgtgcgttg
cagcagagcactttgaagacatgggcgggtaaagaggagaacgtcaaggccgctcaagag
gcgttgtatgtgaggtgcaaggctaactctgaagccacgctcggaacatacaaaggtgat
gctaagcttggtgatggagccgcggagagccttcacgtgaaggactacaagtactga

KEGG   Brassica napus (rape): 106428297Help
Entry
106428297         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 5, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106428297
   00030 Pentose phosphate pathway
    106428297
   00051 Fructose and mannose metabolism
    106428297
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106428297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106428297
   03036 Chromosome and associated proteins [BR:bna03036]
    106428297
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106428297
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106428297
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106428297
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106428297
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106428297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106428297
NCBI-ProteinID: XP_013724491
AA seq 358 aa AA seqDB search
MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFSSINVENIESNRQALRELLF
TSPGALPCLSGVILFEETLYQKTSDGKPFVEFLQENGVIPGIKVDKGVVDLAGTNGETTT
QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP
IVEPEVLTDGSHDIKKCAAVTETVLSAVYKALNDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEYTVNALRRTVPPAVPGIVFLSGGQSEEEATQNLNAMNKLDLLKPWTLTFSFGRAL
QQSTLKAWGGKKENVAKAQATFLVRCKANSDATLGKYIAGASGDSAASESLFVKGYSY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttttgtcggcaaatacgcagatgagctgatcaagacggccaagtacattgca
acaccgggaaagggaattttggcggcagatgagagcacaggaaccattgggaaacgattc
tccagcatcaatgttgagaacattgagtccaaccgccaagctctccgtgagcttctcttc
acttccccaggcgctctcccttgcctctccggtgttatcctcttcgaggaaaccctttac
cagaaaacttctgatggcaagccttttgtcgagttcctccaggagaacggagttatcccc
ggaatcaaagtggacaagggtgtggttgatctagcaggaaccaatggtgagaccactact
cagggtctagactcgcttggtgcacgttgccaggagtattacaaggcaggagccaggttt
gccaaatggcgtgctgtcctcaagattggtgccaccgagccgagcgagctctcgatccaa
gagaacgccaaggggctggcacgttatgccatcatctgccaggagaacggactggtccca
atcgtcgagccagaggttctgactgacgggagccacgacatcaagaagtgtgcggctgtg
actgagacggttctttctgccgtgtacaaggccttgaacgaccaccacgtcctcctcgaa
ggcactcttctaaaacctaacatggtcactcccggctcagacagcgctaaggttgcaccg
gaagtgatagctgagtacacagtgaatgctctccgtcgcacggttccacccgcagttcca
ggaatcgtgtttctctcaggaggacagagcgaagaggaagcaacgcaaaatctgaacgca
atgaacaagctcgatctgttgaagccatggacgctcacattctcctttggccgagccctc
cagcaaagcacactcaaggcttggggaggtaagaaagagaacgtagccaaagcacaggcc
acgttcttggtcaggtgcaaggctaactcggacgctacacttgggaaatacattgctggg
gcttctggtgactctgctgcctccgagagcttgtttgtgaaaggatacagttactag

KEGG   Brassica napus (rape): 106430009Help
Entry
106430009         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 4, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106430009
   00030 Pentose phosphate pathway
    106430009
   00051 Fructose and mannose metabolism
    106430009
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106430009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106430009
   03036 Chromosome and associated proteins [BR:bna03036]
    106430009
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106430009
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106430009
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106430009
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106430009
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106430009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106430009
NCBI-ProteinID: XP_013726237
AA seq 132 aa AA seqDB search
MASWMTITMHVSLYKVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEQATVNLNAINQLKG
KKPWSLTFSYGRALQQSTLKAWGGKEENVEKAQKAFLARAKANSEATTGAYKGDAQLGEG
ASESLHVKDYKY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatggatgacgataacaatgcatgtttctctctacaaagtgatcgcagagcac
acggtccgtgcattacagcgtactgtccccgccgcggttccagccgttgtgttcttgtct
ggaggacagagtgaggaacaagcaactgtgaatttaaacgccattaatcagctcaaaggt
aagaaaccgtggagcttgacgttttcgtatggacgtgcgcttcagcagagtacactcaag
gcttggggaggtaaagaggagaatgttgagaaggctcaaaaggcgttcttggctcgagcc
aaggctaactcggaggcaactactggtgcctacaaaggtgatgctcagctcggtgaaggt
gcttctgagagccttcacgttaaagactacaaatactaa

KEGG   Brassica napus (rape): 106438881Help
Entry
106438881         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106438881
   00030 Pentose phosphate pathway
    106438881
   00051 Fructose and mannose metabolism
    106438881
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106438881
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106438881
   03036 Chromosome and associated proteins [BR:bna03036]
    106438881
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106438881
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106438881
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106438881
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106438881
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106438881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106438881
NCBI-ProteinID: XP_013736002
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAVVIRNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctcctgtgttggacaaatcggagtgggtcaag
ggacaaagcgttctcttccgtcagccatcttccgccgccgtcgtcatacgtaaccgcgcc
acctcccttaccgtccgtgccgcttcttcctacgccgatgagcttgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgacaagcatacaggaca
ttgctggtctctgcaccaggactcggacagtacatctccggtgcaatcctgttcgaggag
actctgtatcagtcgaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcagaac
atcgtccccggtatcaaagtcgacaagggtttggtcccacttgttggctctaacaatgag
tcatggtgccaagggctcgatggtctatcctcccgaactgctgcttactatcaacagggt
gctcgtttcgccaaatggcgtactgtcgtgagcattcccaatggtccgtctgctctagct
gttaaagaagctgcttggggccttgcccgatacgctgccatttcacaagacagtggattg
gttccaatagtggagccagagatattgttggacggagaacacgacattgacaggacttac
gaagtagcagagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtattctcctgaagccgagcatggtgactcccggagctgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaaactcctccgcaacagaatccctccg
gccgtccccggaatcatgttcttgtcgggaggacagtctgaattggaggcaacgttgaac
ctgaacgcgatgaaccaagcaccaaacccgtggcatgtatccttctcctacgcacgtgcc
ctgcagaacacatgtttgaaaacatggggaggcagagctgagaacgtgaacgcagctcag
accactctattggctagagccaaggccaattcgctggctcagcttggaaaatacacagga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattga

KEGG   Brassica napus (rape): 106445170Help
Entry
106445170         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 5, cytosolic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106445170
   00030 Pentose phosphate pathway
    106445170
   00051 Fructose and mannose metabolism
    106445170
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106445170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106445170
   03036 Chromosome and associated proteins [BR:bna03036]
    106445170
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106445170
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106445170
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106445170
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106445170
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106445170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106445170
NCBI-ProteinID: XP_013742145
AA seq 358 aa AA seqDB search
MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFSSINVENIESNRQALRELLF
TSPGALPCLSGVILFEETLYQNTSDGKPFVEFLQENGVIPGIKVDKGVVDLAGTNGETTT
QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP
IVEPEVLTDGSHDIKKCAAVTETVLSAVYKALNDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAMNKLDLLKPWTLTFSFGRAL
QQSTLKAWGGKKENVAKAQATFLVRCKANSDATLGKYIAGASGDSAASESLFVKGYSY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttttgtcggcaaatacgcagatgagctgatcaagactgccaagtacattgca
acgccgggaaaggggattctggcggcagatgagagcactggaaccattgggaaacgattc
tccagcatcaatgttgagaacattgagtccaaccgccaagctcttcgtgagctcctcttc
acttccccaggcgctctcccttgcctctccggtgttatcctcttcgaggaaaccctttac
cagaacacttctgatggcaagccttttgtcgagttcctccaggagaacggagttatcccc
ggaatcaaagtggacaagggtgtggttgatctagcaggaaccaatggtgagaccactact
caggggctagactcgcttggggcacgttgccaggagtattacaaggcaggagccaggttt
gccaaatggcgtgcagtcctcaagattggtgccaccgagccgagcgagctctcgatccaa
gagaacgccaaggggctagcacgttacgccatcatctgccaggagaacggactggtccca
atcgtcgagccagaggttttgactgacgggagccacgacattaagaaatgtgcggctgtg
actgagacggttctttctgccgtgtacaaggccttgaacgaccaccacgtcctcctcgaa
ggcactctgcttaaacctaacatggtcactccaggctcagacagcgccaaggttgcaccg
gaagtcattgcggaatacacagtgactgctctccgccgcacggtcccaccagcggttcca
ggaatcgtgttcctctcaggaggacagagcgaagaggaagcaacgctaaatctgaacgca
atgaacaagctcgatctgttgaagccatggacgcttactttctcctttggccgagccctc
cagcaaagcacactcaaggcttggggaggtaagaaagagaacgtagccaaagctcaggcc
acgttcttggtcaggtgcaaggctaactcggacgctacacttgggaaatacattgctggg
gcttctggtgactctgctgcctccgagagcttgtttgtgaaaggatacagttactag

KEGG   Brassica napus (rape): 106446362Help
Entry
106446362         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 1, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106446362
   00030 Pentose phosphate pathway
    106446362
   00051 Fructose and mannose metabolism
    106446362
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106446362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106446362
   03036 Chromosome and associated proteins [BR:bna03036]
    106446362
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106446362
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106446362
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106446362
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106446362
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106446362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106446362
NCBI-ProteinID: XP_013743524
AA seq 399 aa AA seqDB search
MASSSATMFKASPVKSDWLKGQSLLLRQPSSVSPFRSHVAPSALTVHAASAYADELVKTA
KTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFE
ETLYQSTVDGKKMVDVLVQQNIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRTAAYYQQ
GARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHCIDRT
YEVAEKVWSEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRVP
PAVPGIMFLSGGQSELEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGREENVKAA
QDTLLTRAKANSLAQLGKYTGEGESEDAKEGMFVKGYTY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagctctgcgactatgttcaaagcctcaccggtgaaatctgactggctcaaa
ggacagagtctcctactccgccaaccttcctccgtctcgcctttccgcagccacgtggca
ccttccgctctcaccgtccatgccgcctctgcctacgccgacgagctcgtcaaaacagct
aaaacaatcgcgtctccgggacgcggaatcttagcgatggatgagtcaaacgcgacttgc
gggaagcgtttagcgtcaattgggctagagaacacggaggctaaccgtcaggcttaccgg
acactgctagtgtcggctccaggactgggacagtacatctccggagctatcctgttcgag
gaaactctctaccagtccaccgtcgacggcaagaagatggtcgacgttctcgtccagcag
aacatcgtccctggcatcaaagtcgacaagggtttagtgccacttgttgggtctaacgac
gagtcatggtgccaaggacttgacggtttagcctctcgtaccgctgcttactaccaacaa
ggtgctcgtttcgccaaatggcgtactgttgtgagcattccaaatggaccttctgctttg
gctgttaaagaagcagcctggggacttgcccgctacgccgctatttctcaggacagcggt
ctggtaccgattgtggagccggagattatgttggacggagaacactgcattgacaggaca
tacgaggttgcggagaaggtctggtctgaggtcttcttctatctcgctcagaacaacgtc
atgtttgaaggtatcctcctgaagccaagcatggttactcctggtgctgagtccaaagac
agagctactcccgagcaagttgcttcctacactctcaagctccttcgcaacagagttcct
cccgctgttcccggaatcatgtttctgtctggtggacagtccgagttggaggcgaccttg
aacttgaacgcaatgaaccaaggaccgaacccatggcacgtgtccttctcctatgcacgt
gccttgcagaacacttgcttgaagacatggggaggcagagaagagaacgtgaaggcggct
caggacactctcttgaccagagccaaagccaactcgttggcccagcttgggaaatacaca
ggggaaggtgagtccgaggatgccaaggagggtatgtttgtaaaaggctacacctattaa

KEGG   Brassica napus (rape): 106452433Help
Entry
106452433         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106452433
   00030 Pentose phosphate pathway
    106452433
   00051 Fructose and mannose metabolism
    106452433
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106452433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106452433
   03036 Chromosome and associated proteins [BR:bna03036]
    106452433
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106452433
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106452433
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106452433
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106452433
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106452433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106452433
NCBI-ProteinID: XP_013750000
UniProt: A0A078FFZ8
AA seq 358 aa AA seqDB search
MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaattcgccgatgagttgatcgctaacgccgcatacatcggc
acacccggaaagggtattctcgccgccgatgagtcaaccggaaccatcgggaagcgtctt
gccagcatcaacgtcgagaacgttgagaccaacagacgtgctctccgtgagcttctcttc
accgctcctggtgctctcccttgcctcagcggtgtcatcctcttcgaggaaactctttac
caaaagagctccgatggtaagcttttcgttgatatcttgaaggaaggaggagtactccca
ggtatcaaagtcgacaagggtacagtcgagttagccggaaccaacggcgagaccaccact
cagggtcttgacggtctcggtgaccgttgcaagaagtactacgaagctggtgcacgtttc
gccaagtggcgtgcggttctcaagatcggcgagaacgagccatcagagctttccatccac
gagaacgcttacgggttggctaggtacgctgttatctgccaggagaacggtcttgtaccc
atcgtcgagcctgagattctagtcgacggttcccatgacatccacaagtgcgctgccgtc
accgagcgtgtcctcgcggcttgctacaaggctcttagcgaccaccatgttttgcttgag
ggaactttgttgaagcctaacatggttacacctggatccgacagtgctaaggttgcgcca
gaggtgatcgctgagcatacggttcgtgctcttcagagaacggtcccagcggctgttcca
gctattgtgttcttgtctggaggacagagcgaggaggaggcgaccaagaacttgaacgcg
atgaaccagttgaagaccaagaagccgtggtcgttgtctttctcgttcggacgtgcgttg
caacagagcactttgaagacatgggcaggtaaagaggagaatgtcaaggcagctcaagag
gccttgtatgtgaggtgcaaggctaactctgaagccacgcttggaacttacaaaggtgat
gctaagcttggtgatggagccgcagagagccttcacgtcaaggattacaagtactga

KEGG   Brassica napus (rape): 106454460Help
Entry
106454460         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 3, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106454460
   00030 Pentose phosphate pathway
    106454460
   00051 Fructose and mannose metabolism
    106454460
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106454460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106454460
   03036 Chromosome and associated proteins [BR:bna03036]
    106454460
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106454460
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106454460
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106454460
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106454460
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106454460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106454460
NCBI-ProteinID: XP_013752036
UniProt: A0A078HPC0
AA seq 389 aa AA seqDB search
MASASFVKLNSLSSPRISHRSFAHPSASPPPRVSFAIRAGAYSDELVKTAKTIASPGRGI
LAIDESNATCGKRLASIGLDNTEENRQAYRQLLLTTPGLGDYISGAILFEETLYQSTKDG
KKFVDCLNDAKIVPGIKVDKGLVPLPGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTV
VSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSE
VFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVAEYTLTMLKRRVPPAVPGIMFLS
GGQSEAEATLNLNAMNQSPNPWHVSFSYARALQNSVLRTWQGKPEKIEDSQKALLVRAKA
NSLAQLGKYSAEGENEDAKKGMFVKGYTY
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcaagcttcgtcaagctgaactctctctcttctcctcggatcagccaccgc
tccttcgctcacccctccgcctctcctcctcctcgtgtctccttcgcgattcgcgccggt
gcctactccgacgaactcgtcaaaaccgccaaaacgattgcatcccctgggagaggtatc
ttagcgatcgatgagtcgaacgcaacttgcgggaagaggctcgcttcgattgggttggac
aacaccgaggagaaccgtcaagcctacaggcagcttctgctaacgacccctggcctcgga
gattacatctccggtgctattctcttcgaggagacgctttaccagtcgactaaagacggc
aagaagtttgtcgattgcttgaacgatgccaagatcgtccctggcatcaaagttgacaag
ggcttggttccccttcctggctccaacgaagagtcttggtgccaaggcttggatggattg
gcttcacgttccgctgagtactacaagcaaggcgctcgtttcgccaagtggaggacagtt
gtgagtattccttgcggtccttcagcactagctgtcaaggaagctgcgtgggggttggcg
cgatatgcagccatctctcaggacaacgggcttgtgcctatagtggagccagagattctt
ctggatggtgaccacccgattgagaggacgctggaggttgctgagaaagtgtggtctgag
gtgttcttctacttggcgcagaacaatgttatgttcgagggcatattgttgaagcccagc
atggttaccccaggtgctgagcacaagaacaaggcctctcccgagactgtcgctgagtac
acgctcaccatgctcaagaggagagttcctcctgctgttcccgggatcatgtttctgtct
ggaggacagtctgaggcggaggctacgctgaacctgaacgctatgaaccagagcccgaac
ccgtggcatgtgtccttctcctacgcgcgtgccctgcagaactctgtgctcaggacgtgg
caagggaaacccgagaagatcgaggactcgcagaaggctctcttggttagggcaaaggcc
aactcactggcacagctcgggaaatactcagcggagggagagaatgaagatgccaagaaa
ggaatgtttgtcaagggttacacctactga

KEGG   Brassica napus (rape): 111206734Help
Entry
111206734         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 8, cytosolic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111206734
   00030 Pentose phosphate pathway
    111206734
   00051 Fructose and mannose metabolism
    111206734
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111206734
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    111206734
   03036 Chromosome and associated proteins [BR:bna03036]
    111206734
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111206734
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     111206734
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111206734
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111206734
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   111206734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 111206734
NCBI-ProteinID: XP_022559733
AA seq 358 aa AA seqDB search
MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSAKVAP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATKNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcaccagcaaattcgccgatgagttgatcgctaacgccgcctacatcggc
acacccggaaagggtattctcgccgccgatgagtccaccggaaccatcggaaagcgtctt
gcaagcatcaacgtcgagaacgttgagaccaacagacgtgctctccgtgagcttctcttc
accgcccctggtgctctcccttgcctcagcggtgtcatcctcttcgaggaaactctttac
caaaagagctccgatggcaagcttttcgttgacatcttgaaggaaggaggagtactccca
ggtatcaaagtcgacaagggtaccgtcgagctagccggaaccaacggcgagaccaccact
cagggtcttgacggcctcggtgagcgttgcaagaagtactacgaagctggtgcacgtttc
gccaagtggcgtgcggttctcaagatcggcgagaacgagccatcagagctttccatccac
gagaacgcttacgggttggctaggtacgctgttatctgccaggagaacggtcttgtaccc
atcgtcgagcctgagattctagtcgacggttcccatgacatccacaagtgtgctgctgtg
accgagcgtgtcctcgcggcatgctacaaggctcttagcgaccaccatgttttactcgag
ggaactctcttgaagcctaacatggttactccaggatccgacagtgctaaggttgcaccg
gaggtgatcgctgagcacaccgtgcgcgcccttcagagaacggtcccagcggctgttcca
gctatcgtgttcttgtctggaggacagagcgaggaggaggcgaccaagaacctgaacgcg
atgaaccagttgaagaccaagaagccgtggtcgttgtctttctcgttcggacgtgcgttg
caacagagcactttgaagacatgggcaggtaaagaggagaatgttaaggctgctcaagag
gccttgtatgtgaggtgcaaggctaactctgaagccactcttggaacttacaaaggtgat
gctaagcttggtgatggagccgcagagagccttcacgtaaaggactacaagtactga

KEGG   Brassica napus (rape): 111207118Help
Entry
111207118         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111207118
   00030 Pentose phosphate pathway
    111207118
   00051 Fructose and mannose metabolism
    111207118
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111207118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    111207118
   03036 Chromosome and associated proteins [BR:bna03036]
    111207118
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111207118
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     111207118
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111207118
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111207118
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   111207118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 111207118
NCBI-ProteinID: XP_022560498
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSASVVLPNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctccagtgctggacaaatctgagtgggtcaag
ggccaaagcgttctcttccgtcagccttcttccgcatccgtcgtactacctaaccgtgcc
acatctctcaccgtccgtgccgcttcttcctacgccgatgagcttgtcaagacagcgaaa
acaattgcatctccgggacgtggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcgtacaggact
ttgcttgtctctgcaccaggtctcggacagtacatctccggggcaatcttgttcgaggag
actctctatcagtccaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcaaaac
atcgtccccggtatcaaagttgacaagggtttggtgccacttgttggctctaacaatgag
tcatggtgtcaaggactcgatggtctatcctctcgcactgctgcttactaccaacagggt
gctcgtttcgctaaatggcgtactgtcgtgagcattcccaacggcccgtctgcactcgct
gtgaaagaagctgcttggggccttgctcgctacgctgccatttcacaggacagtggattg
gtcccaattgtggagccagagatcttgttggacggagaacacgacattgacaggacttac
gaagttgctgagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgccgcctacacccttaagctcctccgcaacagaatccctcct
gccgtccccggaatcatgttcttgtccggaggacagtctgagttggaggcaacgttgaac
ctcaacgcgatgaaccaggcaccaaacccatggcacgtgtccttctcctacgcacgtgct
ctccagaacacttgtctgaaaacatggggaggcagagctgagaacgtgaacgctgctcag
accactctcttggctcgtgccaaggccaactcgttggctcagcttggaaaatacaccgga
gaaggcgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattga

KEGG   Brassica napus (rape): 111210709Help
Entry
111210709         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111210709
   00030 Pentose phosphate pathway
    111210709
   00051 Fructose and mannose metabolism
    111210709
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111210709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    111210709
   03036 Chromosome and associated proteins [BR:bna03036]
    111210709
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111210709
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     111210709
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111210709
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111210709
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   111210709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 111210709
NCBI-ProteinID: XP_022566932
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAVVIRNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcatctcctgtgttggacaaatcggagtgggtcaag
ggacaaagcgttctcttccgtcagccatcttccgccgcagtcgtcatacgtaaccgtgcc
acctcccttaccgtccgtgccgcttcttcctacgccgatgagcttgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacttgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgacaagcatacaggaca
ttgctggtctctgcaccaggactcggacagtacatctccggtgcaatcctgttcgaggag
actctgtatcagtcgaccaccgaaggcaagaaaatggtcgacgtccttgtcgagcagaac
atcgtccccggtatcaaagtcgacaagggtttggtcccacttgttggctctaacaatgag
tcatggtgccaagggctcgatggtctatcctcccgaactgctgcttactatcaacagggt
gctcgtttcgccaaatggcgtactgtcgtgagcattcccaatggtccgtctgctctagct
gttaaagaagctgcttggggccttgcccgatacgctgccatttcacaagacagtggattg
gttccaatagtggagccagagatattgttggacggagaacacgacatcgacaggacttac
gaagtagcagagaaggtctgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtattcttctgaagccgagcatggtgactcccggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaaactcctccgcaacagaatccctccg
gccgtccccggaatcatgttcttgtcgggaggacagtctgagttggaggcaacgttgaac
ctgaacgcgatgaaccaagcaccaaacccgtggcatgtatccttctcctacgcacgtgcc
ctgcagaacacatgtttgaaaacatggggaggcagagctgagaacgtgaacgcagctcag
accactctattggctagagccaaggccaattcgctggctcagcttggaaaatacacagga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctattga

DBGET integrated database retrieval system