KEGG   Brassica napus (rape): 106349790Help
Entry
106349790         CDS       T04128                                 

Definition
(RefSeq) glutathione S-transferase U18-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bna  Brassica napus (rape)
Pathway
bna00480  Glutathione metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106349790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bna02000]
    106349790
Enzymes [BR:bna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106349790
Transporters [BR:bna02000]
 Other transporters
  Pores ion channels [TC:1]
   106349790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 106349790
NCBI-ProteinID: XP_022556389
AA seq 160 aa AA seqDB search
MVTGDVKLIGSWASVFVMRTRIALNLKSISYEFLQETYGTKSELLLKSNPVHKKMPVLIH
ADKPVCESNIIVQYIDEAWSSYGPSILPSQPYDRAIARFWAAYVDDKWFIALRSILTARG
EEEKKAAIAEVEERTDHLEKAFIECSNGKLITRLSTHQLT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccggcgacgtaaagctgattggctcatgggctagtgtcttcgtcatgaggacc
agaatcgctctcaacctcaaatctattagctacgagtttctccaggagacatacggtact
aagagcgagttgctccttaaatctaacccggttcacaagaagatgccggttctgattcat
gctgacaaacccgtgtgtgagtccaacatcatcgttcagtacatcgacgaggcttggagc
tcatatggaccgtctattctcccttctcagccctacgacagagccatcgctcggttctgg
gccgcctacgtagatgataagtggtttattgctctgagaagtatcctaaccgctcgagga
gaagaggagaagaaagcagccatagctgaagtcgaagaaaggactgaccatttagagaaa
gccttcatcgagtgcagcaatgggaaactgattacgcgtttgagcacacaccaattaacc
taa

DBGET integrated database retrieval system