KEGG   Brassica napus (rape): 106350081Help
Entry
106350081         CDS       T04128                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
Organism
bna  Brassica napus (rape)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106350081
NCBI-ProteinID: XP_022543927
AA seq 367 aa AA seqDB search
MRHMKNIELRKQFFEQNGGGVLRQRLSGEGPSNVDVKIFTEEGMKKATNGYEASRILGQG
GQGTVYKGILPDSSVVAIKKSRLGDSSQVEQFINEVLVLSQINHRNVVKLLGCCLETEVP
LLVYEFVTNGTLFDHLDGSLFNSSLTWEHRLRIAIEVAGTLAYLHSSASIPVIHRDIKTA
NILLDENLTAKVADFGASKLIPMNKEQLTTMVQGTLGYLDPEYFTTGLLNEKSDVYSFGV
VLMELLSGQKALCFERPEYSRHLVSYFSCATKEKRLNEIIDSQVMNEYNRREILEAALIS
VECTRLMGEERPRMKEVAAKLEGLRVSETKHQWSDRYTEPRVNEQLSYVETISAQGDMSS
SGYASRM
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagacacatgaaaaacattgagctacggaaacaattctttgagcaaaacggtggtggc
gtgttgaggcagcgactctcaggagaagggccatcaaatgttgatgtcaaaatatttacg
gaggaaggcatgaaaaaagcaactaatggttatgaagcaagcagaatcttgggtcaggga
ggccagggaacagtttacaaagggatattaccagacagctcagtagttgctataaagaaa
tctcggcttggagacagcagccaagtagagcagttcatcaacgaagtgctagttctttca
cagatcaaccataggaacgtggtcaagctcttgggctgctgtctagagactgaagttccc
ttgctggtctatgagtttgtaactaatggcaccctttttgatcacttggacggttccttg
tttaattcttctcttacatgggaacaccgcctgaggatagcaatagaagtcgctggaact
cttgcctaccttcactcttctgcttctattccagtcatccaccgtgatatcaagactgct
aatattctcctggatgagaacttaactgccaaagtagcagactttggtgcttcaaagctg
ataccgatgaacaaagagcagctcacgactatggtacaaggcactctgggttacctagac
ccggaatacttcaccacagggttgctgaatgaaaagagtgacgtttacagctttggggta
gtcctgatggaacttctctcaggtcaaaaggcattgtgctttgaaaggccagagtactca
agacacttggtgagttacttttcttgtgccacaaaagagaaaagattgaatgagattata
gacagccaagtaatgaacgagtataatcggagggagattctggaagctgcactaatttct
gttgagtgcacaagactgatgggagaagaaagaccgaggatgaaagaagtagctgcaaag
cttgagggcttgagagtctcggaaaccaaacatcagtggtcggatcggtatactgagcca
agggtgaatgagcaactgagctatgttgaaaccatatcagcgcaaggggatatgagtagc
tctggttatgcatcaagaatgtag

DBGET integrated database retrieval system